KEGG   Nitrosomonas sp. AL212: NAL212_0867Help
Entry
NAL212_0867       CDS       T01443                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NAL212_0867
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     NAL212_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759204..759989
Genome map
AA seq 261 aa AA seqDB search
MSNDTFNLGKEQLIQQSLEQMDKHLQGAHYTPTQKLALTCRILFDNGHDSGLAGQITARG
EQPGTYLTQRLGFGFDEICASNLLLVNEDLEVLQGDGMANPANRFHSWLYRARPDVQCII
HTHAVHTAALSMLEVPLEISHMDNCVLYDDVAFLPQWPGVPVGNDEGEMISKAIGNRHAL
LLAHHGLLIASSSIEEGCILALAFERAARMHLLAACAGRIQPIDPGLGREARDWILRGQR
STVAFAYYARRTLRKGADCLK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacactttcaacttaggcaaagaacaattgatccagcaatcgctggagcaa
atggataagcacttgcaaggcgcacattatacaccgacgcaaaagttggcgttgacctgt
aggattttgtttgataacgggcatgattcaggactagcgggacaaattactgcacggggc
gaacaaccgggtacttatttgacgcaacggctgggatttggcttcgacgaaatttgcgcc
agcaatttattgctcgtcaatgaagatttggaagtgctgcaaggcgatggcatggccaat
ccggccaatcgattccattcctggctgtatcgcgcacgacctgatgtgcagtgcattatt
catacgcacgccgtacataccgctgcgctgagcatgcttgaagtgccgttggaaatatcg
cacatggataattgcgtgctctatgacgatgtggctttcttaccccagtggccgggtgtt
ccggtcggcaatgatgaaggcgaaatgatttccaaggcgatcggtaacagacatgcttta
ttgttagcccatcacggtttattgatcgccagttcgagtattgaagaaggatgtatactg
gcgcttgcttttgaacgggcggcacgcatgcatttgctggcagcatgcgcgggtaggatt
cagccgattgatcccggtttagggcgcgaagcacgcgactggattctgcgcggacaacgt
agtaccgtggcttttgcatattatgcacgacgtactttaagaaagggggcggattgcctg
aagtag

DBGET integrated database retrieval system