KEGG   Nitrosomonas sp. AL212: NAL212_0942Help
Entry
NAL212_0942       CDS       T01443                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nit  Nitrosomonas sp. AL212
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
846931..848844
Genome map
AA seq 637 aa AA seqDB search
MNQFANASPSVIARETLKQLAILKIQPTPESYFKLYNQIAGNPDSQVCAVTAKLLMELAK
EFPRHTPPLLNCANNLEQAVKDKSWSDFKSVLVKFVATVTASNKTVPPTETAKSIPGASW
VKIIDSLFDDLVDSENFPGIVNKRKELKYVLDEFSDDPELAYSKLMALVQSWKGSDSISQ
ESEESIENISISISVSDAKSFKQQSEPKEDILAQEYQISGYTDQLLELLAQILEQVIANQ
IEDKILAGEARSLGKQVKKIQSKLGMEQFMASFQRFCVKLELGNEDKSNIQQGLLKLLSM
LMDSTSELLSEDQWIKLQVSKLKKAMSRPLDMQIIAQAEFSLGKIIQRQVKVKQSLGKAR
ETMRQMVTSLISNLEELSDATGGYHEKLEYYSERINHINNIEDINQLLADIMQDTQKVQN
NVLKYRNDLVFARAEINEAQNQINQLETQLQEMSEQVQEDHLTGALNRRGFDKAFEREIT
QLARSQGTLCFALLDIDNFKQLNDTHGHHVGDDALKYLVEAVKETVRRDDVISRYGGEEF
AILLPNSGLKAAISTVARIRRYLTKKFFLHGNNRLLITFSAGVAQYQPGESQESLFKRTD
EALYFAKRNGKNQIVAAEEAVSAGEICKSHLNPVNAI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttgctaatgctagcccatccgtgattgcacgggagacattaaagcagctt
gctatactcaaaatacaacccactcctgaaagttattttaagctgtacaaccaaatagca
ggtaatccggatagtcaggtttgtgctgttacggcaaaattactaatggaactggcaaaa
gaatttccgcgtcatacaccgcctttactcaactgtgccaataacttagaacaggctgta
aaagacaagagttggtctgattttaaatctgtattggtaaaatttgttgcaaccgtaacg
gcttctaataagactgttccaccgactgaaactgcaaaatccataccaggagcatcctgg
gtaaaaattattgacagcttattcgatgatctcgttgattcggaaaattttcctgggatt
gtaaataaaagaaaagaattaaaatatgtattggatgaattttctgatgatcctgaactt
gcttacagcaaattaatggcattggttcagtcatggaaaggttcggattctatttctcaa
gagtctgaagagagtatagaaaacatatcgatatcgatatcggtatcagatgcaaaatct
tttaagcaacaatctgaacccaaagaagatattctggcacaagaatatcaaatcagcggt
tatacagaccaattgctggaattgctggcgcagattctggagcaggttattgctaatcag
attgaagataaaattctggcgggcgaggccagatctctgggtaagcaggttaaaaaaatt
caaagtaagctgggaatggaacaattcatggcgagctttcagagattctgtgtcaagttg
gaattgggtaatgaggacaaatcgaacatacaacaaggtttgcttaaattattaagtatg
ctgatggatagcacaagcgaattgttgtcggaagatcagtggattaaattacaggtttcc
aaattaaagaaagctatgtctaggccactggatatgcagataatagcgcaagctgaattt
tcgcttggaaaaataatacaaaggcaggtcaaagtaaaacaaagcctgggcaaagccagg
gaaactatgcggcaaatggtaacttccctaatttccaatcttgaggaactttcagatgct
acaggcggatatcatgaaaaattggaatactactccgaaagaatcaatcatatcaataat
attgaagatataaatcagctgcttgcagatataatgcaagatacccagaaagtgcagaat
aatgtgctgaaatatcgcaatgacttggtatttgcgcgtgcagaaattaatgaagcacaa
aatcaaatcaatcagctagaaacgcaattgcaggaaatgagcgaacaagtgcaagaagat
catctgacgggtgcacttaatcgacgaggatttgataaggcattcgaacgcgagattaca
caattagctcgcagtcagggaacactttgttttgctctgttggatattgataattttaag
cagttaaacgatacgcatggacatcatgtgggtgatgatgcattgaaatacctggttgaa
gcggtcaaagaaactgtgcgtcgggatgatgtgatatcacgttatggtggagaggaattt
gcaattttgttgcctaattccgggttaaaagcggcgatatcaacagttgcgaggatacgg
cgctatctaaccaagaaattctttttgcatggaaacaatcgattgttaattacatttagc
gccggtgtggcccaatatcagccgggggaatctcaggaaagcttgtttaaacgtactgac
gaagcgttatattttgctaagagaaatggtaagaatcagattgttgcagctgaggaggct
gtgtcagccggcgaaatttgtaaaagtcatttaaatccggttaacgccatttga

DBGET integrated database retrieval system