KEGG   Nitrosomonas sp. AL212: NAL212_0942Help
Entry
NAL212_0942       CDS       T01443                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
nit  Nitrosomonas sp. AL212
Brite
Enzymes [BR:nit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     NAL212_0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
846931..848844
Genome map
AA seq 637 aa AA seqDB search
MNQFANASPSVIARETLKQLAILKIQPTPESYFKLYNQIAGNPDSQVCAVTAKLLMELAK
EFPRHTPPLLNCANNLEQAVKDKSWSDFKSVLVKFVATVTASNKTVPPTETAKSIPGASW
VKIIDSLFDDLVDSENFPGIVNKRKELKYVLDEFSDDPELAYSKLMALVQSWKGSDSISQ
ESEESIENISISISVSDAKSFKQQSEPKEDILAQEYQISGYTDQLLELLAQILEQVIANQ
IEDKILAGEARSLGKQVKKIQSKLGMEQFMASFQRFCVKLELGNEDKSNIQQGLLKLLSM
LMDSTSELLSEDQWIKLQVSKLKKAMSRPLDMQIIAQAEFSLGKIIQRQVKVKQSLGKAR
ETMRQMVTSLISNLEELSDATGGYHEKLEYYSERINHINNIEDINQLLADIMQDTQKVQN
NVLKYRNDLVFARAEINEAQNQINQLETQLQEMSEQVQEDHLTGALNRRGFDKAFEREIT
QLARSQGTLCFALLDIDNFKQLNDTHGHHVGDDALKYLVEAVKETVRRDDVISRYGGEEF
AILLPNSGLKAAISTVARIRRYLTKKFFLHGNNRLLITFSAGVAQYQPGESQESLFKRTD
EALYFAKRNGKNQIVAAEEAVSAGEICKSHLNPVNAI
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttgctaatgctagcccatccgtgattgcacgggagacattaaagcagctt
gctatactcaaaatacaacccactcctgaaagttattttaagctgtacaaccaaatagca
ggtaatccggatagtcaggtttgtgctgttacggcaaaattactaatggaactggcaaaa
gaatttccgcgtcatacaccgcctttactcaactgtgccaataacttagaacaggctgta
aaagacaagagttggtctgattttaaatctgtattggtaaaatttgttgcaaccgtaacg
gcttctaataagactgttccaccgactgaaactgcaaaatccataccaggagcatcctgg
gtaaaaattattgacagcttattcgatgatctcgttgattcggaaaattttcctgggatt
gtaaataaaagaaaagaattaaaatatgtattggatgaattttctgatgatcctgaactt
gcttacagcaaattaatggcattggttcagtcatggaaaggttcggattctatttctcaa
gagtctgaagagagtatagaaaacatatcgatatcgatatcggtatcagatgcaaaatct
tttaagcaacaatctgaacccaaagaagatattctggcacaagaatatcaaatcagcggt
tatacagaccaattgctggaattgctggcgcagattctggagcaggttattgctaatcag
attgaagataaaattctggcgggcgaggccagatctctgggtaagcaggttaaaaaaatt
caaagtaagctgggaatggaacaattcatggcgagctttcagagattctgtgtcaagttg
gaattgggtaatgaggacaaatcgaacatacaacaaggtttgcttaaattattaagtatg
ctgatggatagcacaagcgaattgttgtcggaagatcagtggattaaattacaggtttcc
aaattaaagaaagctatgtctaggccactggatatgcagataatagcgcaagctgaattt
tcgcttggaaaaataatacaaaggcaggtcaaagtaaaacaaagcctgggcaaagccagg
gaaactatgcggcaaatggtaacttccctaatttccaatcttgaggaactttcagatgct
acaggcggatatcatgaaaaattggaatactactccgaaagaatcaatcatatcaataat
attgaagatataaatcagctgcttgcagatataatgcaagatacccagaaagtgcagaat
aatgtgctgaaatatcgcaatgacttggtatttgcgcgtgcagaaattaatgaagcacaa
aatcaaatcaatcagctagaaacgcaattgcaggaaatgagcgaacaagtgcaagaagat
catctgacgggtgcacttaatcgacgaggatttgataaggcattcgaacgcgagattaca
caattagctcgcagtcagggaacactttgttttgctctgttggatattgataattttaag
cagttaaacgatacgcatggacatcatgtgggtgatgatgcattgaaatacctggttgaa
gcggtcaaagaaactgtgcgtcgggatgatgtgatatcacgttatggtggagaggaattt
gcaattttgttgcctaattccgggttaaaagcggcgatatcaacagttgcgaggatacgg
cgctatctaaccaagaaattctttttgcatggaaacaatcgattgttaattacatttagc
gccggtgtggcccaatatcagccgggggaatctcaggaaagcttgtttaaacgtactgac
gaagcgttatattttgctaagagaaatggtaagaatcagattgttgcagctgaggaggct
gtgtcagccggcgaaatttgtaaaagtcatttaaatccggttaacgccatttga

DBGET integrated database retrieval system