KEGG   Nitrosomonas sp. AL212: NAL212_0979Help
Entry
NAL212_0979       CDS       T01443                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NAL212_0979
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_0979
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NAL212_0979
Enzymes [BR:nit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NAL212_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
894800..895663
Genome map
AA seq 287 aa AA seqDB search
MSLDSIKNLLNFFSGQSDAKRTNRIAKTFAKLKQQNRKALIPFITAGDPHPKYTVPLMHQ
LVESGADIIELGVPFSDPMADGPTIQRSSERALKHHVSLDDVLRLVVEFRKINTNTPVVL
MGYANPVEALGHISFAVKARDCGVDGVLIVDYPPEESSEWVQCLEQHQIDAIFLLSPTTH
QQRIEQVAKIAKGYIYYVSLKGVTGASHLDLQDVGTKLEQLRQYISLPIGVGFGIRDGAT
ARAIAELADAVVVGSRIIEEIEKSSESDLLRNVGNQIKALRDAIDEN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcctagatagtattaaaaatttactaaatttttttagcgggcaaagcgatgctaaa
agaaccaatcgtattgctaaaacatttgccaaattaaaacaacaaaatcggaaggctttg
attcctttcattacggcgggtgatccacatccaaaatatactgttccattgatgcatcaa
ttggttgagtcaggtgctgatattattgagttgggggttcctttttccgatcccatggca
gatgggcctactattcaaagatcttcagaacgagctttaaaacatcatgttagtctggat
gatgtgttgaggttggtggttgaattcagaaaaataaatacaaatacgccagttgttttg
atgggatatgcaaatcctgttgaagcactaggtcatatttcatttgctgttaaagcgaga
gactgtggggttgatggcgtgcttattgttgattatcctccggaagaatcaagtgaatgg
gtacaatgtttggagcagcatcaaattgatgcaatctttttattgtctcccacaacgcat
caacagcgcatcgagcaagtggcaaagatagcgaaaggctatatttactatgtttctcta
aaaggggttaccggtgcatcgcaccttgatctgcaggatgtcggcaccaagctggaacaa
ttgcgtcagtatatttccttgccaatcggcgttggatttggcatacgcgatggtgcgaca
gccagggcgattgcagaattggcagatgctgtggttgtaggtagcagaataattgaggaa
attgagaagtcttctgagtcagatttattaagaaatgtcgggaatcagataaaagcgcta
cgtgatgctattgatgagaattag

DBGET integrated database retrieval system