KEGG   Nitrosomonas sp. AL212: NAL212_1079Help
Entry
NAL212_1079       CDS       T01443                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nit  Nitrosomonas sp. AL212
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAL212_1079
   00670 One carbon pool by folate
    NAL212_1079
Enzymes [BR:nit01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NAL212_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
998047..998550
Genome map
AA seq 167 aa AA seqDB search
MISMRLSILVAMAKNRVIGQNNQLPWHLPADLKHFKFLTMGQTIVMGRKTYESIGRPLPG
RENIIITRQSGYDVQGATVVNSLEDALLICEESSTINNESFIIGGEKLYRQTLDICQRMY
ITEIQSDFEGDVVFPEFDRNNWEEIQRDKHISDAQIEYHFVILERKV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaatgcgcctttctatcctggtggctatggctaagaatcgagttattggccaa
aataatcaattgccctggcatttgccggctgatcttaagcactttaagttcctgacaatg
ggtcaaaccattgtgatgggaagaaaaacctatgagtcgatcggtagaccgttacccgga
cgagagaatattattattacccggcaatcaggttatgacgtgcaaggagcaactgtagtg
aattctcttgaagatgccttgttgatatgcgaagaaagtagcacgatcaataatgaaagc
tttattattggtggtgagaagctataccggcaaacactggatatttgccagagaatgtat
attactgaaatacagagtgattttgaaggtgatgtagtttttccggaatttgatcgcaac
aactgggaagaaatacagcgcgataagcatatatcagatgcgcaaatcgaatatcatttt
gtcattcttgagcgtaaagtatga

DBGET integrated database retrieval system