KEGG   Nitrosomonas sp. AL212: NAL212_1096Help
Entry
NAL212_1096       CDS       T01443                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nit01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1019277..1019843)
Genome map
AA seq 188 aa AA seqDB search
MVFGDSLSSSYGISTEAGWVTLLEQRLQSKYADYRIINASISGETALGGRNRIRQALETH
RPEIVIVELGGNDGLRGTSIQSIYENLAAIIEECQQNNALVLLAGMQLPPNYGKTYTQKF
QAIFPQLAERYQIKLIPFLLAGFGDKHEFFQADGIHPTEVAQKKIVENVWEVLQTMFKTE
QIATNPDI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggtctttggcgatagcctatcctccagctatggcatatcgaccgaagcaggctgggtt
acactgctggaacaacgattacagtcaaagtatgctgattatcgcatcattaacgcaagc
atcagcggcgaaacggcattgggtggtcgcaatcgaatccgacaagcgcttgaaacacat
cgccccgaaattgttatcgttgaacttggtggaaatgacggtttacgcggcacatcgatc
caatccatttatgaaaacctggctgccattatagaagaatgtcaacaaaacaacgcactg
gttttacttgccggcatgcagttaccaccgaattatggcaaaacgtatacgcaaaaattc
caagccatctttccgcaattggccgagcgttatcaaatcaaattaataccattcttacta
gctggttttggcgataaacacgaattcttccaagctgatggaatacatcctaccgaagtc
gcacagaaaaaaattgtagaaaatgtctgggaagttttgcaaaccatgtttaaaactgaa
caaattgccaccaatccggatatttag

DBGET integrated database retrieval system