KEGG   Nitrosomonas sp. AL212: NAL212_1165Help
Entry
NAL212_1165       CDS       T01443                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NAL212_1165
Enzymes [BR:nit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NAL212_1165
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAL212_1165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1078731..1079735
Genome map
AA seq 334 aa AA seqDB search
MFTYCRFPQRRMRRMRHDKFSRNLMREAHLLPDDFIYPVFVLDGKNRSENIESMPGVVRQ
SIDILMVQAERCMRLGIPALAIFPVIDIEQKNLTASEAYNPDGLVPRTIRQLKTSFPELG
VITDIALDPYTIHGQDGLIDQFGYVMNDETVQVLCQQALIHAQAGADIVAPSDMMDGRIS
AIRNSLDNHKLIHTRILAYSAKYASSFYGPFRDAVGSSKNLGTGNKYTYQMDPANSDEAL
WEVGLDLEEGADMVMIKPGMLYLDIIRRVKDQFRAPTFVYQVSGEYAMLKASVINGWLNE
ESCVLESLLAFKRAGADGILTYYAIEAAEWLKKT
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtttacctattgtcgttttcctcagagaagaatgcgtcgaatgcggcacgataagttc
tctcgtaatttgatgcgagaagctcatcttctgccagatgattttatttacccggttttt
gttttagatggaaaaaatcgtagtgaaaatatcgaatcaatgcctggagtagtgaggcag
agtatcgatattttaatggttcaggcagagagatgcatgcgccttggtattccagcactt
gctatttttccagttatagatatcgagcagaagaatctaacagctagcgaggcatataat
cctgacggacttgtgccgcgaacaataagacaactaaagactagctttcctgagttggga
gtaattaccgatattgctttggatccatatacaattcacggtcaagatggtttgatcgat
cagtttggttatgtgatgaacgatgaaacagtacaggttctttgtcagcaagcattgatt
catgctcaggcaggtgcagatatcgttgctccttcggatatgatggatgggcgtatttca
gcaattagaaatagtttagacaatcataaacttattcatacgcgcattctagcctattct
gcgaagtacgcctctagtttttatggcccatttcgcgatgctgtgggatcctctaagaat
ctaggtactggtaacaaatatacttatcaaatggatcctgcgaattccgatgaagcgtta
tgggaagttggattagatttggaggagggtgccgatatggtaatgattaaaccgggcatg
ctttatttagatatcattcgtcgtgtgaaagatcaattcagggcgcctacatttgtttat
caagtgagtggtgagtatgcaatgctcaaagcctctgtaatcaatgggtggttaaatgaa
gaatcttgtgtattggaatcattgcttgctttcaagcgtgcgggcgcggacggaattctg
acttattatgcgatcgaggcggctgaatggctcaaaaaaacttaa

DBGET integrated database retrieval system