KEGG   Nitrosomonas sp. AL212: NAL212_1323Help
Entry
NAL212_1323       CDS       T01443                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00020  Citrate cycle (TCA cycle)
nit00640  Propanoate metabolism
nit00660  C5-Branched dibasic acid metabolism
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01120  Microbial metabolism in diverse environments
nit01130  Biosynthesis of antibiotics
nit01200  Carbon metabolism
Module
nit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nit_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAL212_1323
   00640 Propanoate metabolism
    NAL212_1323
   00660 C5-Branched dibasic acid metabolism
    NAL212_1323
Enzymes [BR:nit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NAL212_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A FbpA
Motif
Other DBs
NCBI-ProteinID: ADZ26219
JGI: NAL212_1323
UniProt: F9ZHS1
Position
complement(1233825..1234985)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQAKEILRKYNITTPRGIACFSVNEAVQAAQQLGGEVWAVKAQIYAGGRGKGGGV
KVAKSLEEVRQYAGEILNMRLITHQTGPEGQIVHRLFIEQGVQIEKEFYIGMVVDRGHQR
VCLMASSEGGTEIEKVAAEMPEKIHKVLIDPITGLGQQQAEEVAQKIGIPKHSLSDAVTL
LQCLYQAFDETDASLLEINPLVLTAGHRVMALDAKMNFDDNALFRHPEIVALRDLDEEDP
IEIEASKHELSYIPLDGNIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATTEKVTE
AFKLMLRNPKLQGILVNIFGGIMKCDVIAQGVVAAARDVQLTVPLVVRLEGTNVNLGKKI
LADSGLKIISADNMADAAQKAVSAAG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatgagtaccaagctaaagaaattttacgcaaatataatataaccactcca
agaggtattgcctgctttagtgttaacgaagcagtgcaagctgcgcaacaactagggggc
gaagtgtgggcagtgaaagctcagatttatgctggcggacgtggtaaaggcggtggagta
aaagtggctaagtcattggaagaagtacgacaatatgctggcgaaattttgaacatgcgc
ttgataactcatcagaccggcccggaaggacagatagtccatagactttttatcgagcaa
ggcgtacagatagaaaaagaattctatataggcatggtggtagaccgcggtcatcaacgt
gtatgtttgatggccagttcggaaggtggcacggaaattgagaaagtcgcagctgaaatg
cccgaaaaaattcataaagtgcttattgatcccatcacgggcttaggccaacaacaggct
gaagaagtcgcacaaaaaattggcatccccaaacatagcctgtcagatgctgtcaccttg
ctgcaatgcttatatcaagcatttgatgaaaccgatgcatcattactggaaatcaatcca
ttggtattgactgcaggacatcgggtgatggcactcgacgccaaaatgaattttgatgat
aatgcattgtttcgccatcccgaaatcgtcgcgttacgtgatttggatgaggaagatccc
atcgagatcgaagcatcaaaacatgaattgtcatatattcctctggacggaaatataggc
tgtctggtaaatggcgcaggcctagcaatggcaacgatggatatcatcaaactttacggc
ggtaatcctgctaactttctcgatgttggaggtggagcgacaacagagaaagtcacggaa
gcatttaaattaatgcttcgcaacccgaaactgcaaggaatcctggttaatatcttcggc
ggcataatgaaatgtgatgtcattgcacaaggtgttgtagcagctgctcgcgatgttcag
cttacggtgccattggtggtgcggctggaaggtaccaatgtcaatctcggaaagaaaatt
ctggcagattccgggttaaagatcatttctgcggataatatggctgatgcggcgcaaaaa
gcggttagcgcagccggataa

DBGET integrated database retrieval system