KEGG   Nitrosomonas sp. AL212: NAL212_1350Help
Entry
NAL212_1350       CDS       T01443                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nit00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1265003..1265620)
Genome map
AA seq 205 aa AA seqDB search
MIKTPGCLFIISAPSGAGKTSLVRELLQSGLNLNLSISHTTRPPRSGEINGRDYHFVNEE
KFKQMLFNGEFVESAEVYGNLYGTSQHWLNDAMTCGQDILLEIDCQGAKQIQQIFPHSIG
IFILPPSVEALATRLKTRAQDDSEVIKKRLMAAREEINHIAEFNYIIVNNNLNEALSDLI
CIVKAERLKTERQIMRHRTLVTQLS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaactccaggttgtttatttattatcagtgcaccatcaggagccggaaaaacc
agtctggttcgagaattactgcagtcaggtttgaatcttaatttatccatctcacacacc
acccgaccaccccgcagtggagaaatcaatggccgcgactatcacttcgtgaatgaagaa
aaattcaaacaaatgctatttaatggcgaatttgtggaaagtgcggaagtttatggcaat
ctttacggtacctcgcaacactggctcaatgacgccatgacttgcgggcaggatattttg
cttgaaatagattgccagggagcaaaacaaatacagcaaatttttcctcattctatcggc
atttttattctcccaccttcagtcgaagcgttggcaacgcggctaaaaactcgtgcgcag
gatgattccgaggtcatcaagaaacggcttatggcggctcgggaagaaatcaatcatatc
gcagagtttaattacatcattgttaacaacaacctgaatgaggcactcagcgatttaatt
tgcattgtcaaagctgaacgcttaaaaacggaacggcagattatgagacaccgaactttg
gttacccaactatcataa

DBGET integrated database retrieval system