KEGG   Nitrosomonas sp. AL212: NAL212_1449Help
Entry
NAL212_1449       CDS       T01443                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:nit01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nit01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1378073..1379263
Genome map
AA seq 396 aa AA seqDB search
MIYDFLNLISGVVDMPWWGYIVITLIFTHITIAAITIYLHRHSAHRALELHAIPSHFFRF
WLWLTTGMVTKEWTAIHRKHHAKCETKEDPHSPVVYGIEKVLAEGSELYRAEAKNAETLK
RYGYGTPDDWLERNVYSRHSAKGVALMLIINVILFGPIGITIWAVQMLWAPVFAAGIING
VGHYWGYRNFQAEDASKNIVPWGILIGGEELHNNHHAYATSARLSNKWYEFDIGWMYIRI
LEMLGLAKVKKVAPKLRIDQAKTQCDSDTLQAVISHRYEVLAKYTKSLKATFAKEMIHLK
EATIHYGVDSSTLKRWVLADSKTLQDHEREKLTQVLSNAKTLDKVYTMRDELAQIWQRST
ATTEELVKQLEDWCRRAEESGIEVLRVFSQRLRCYA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgattttcttaatttaatttcgggtgtggtggatatgccgtggtggggttat
attgttattaccctgatttttacgcatattacaattgctgctattacaatttacttacac
cgtcattcggcgcacagagctttggagttacatgccataccaagtcatttttttcgtttc
tggctctggctgacgactggaatggttacaaaggaatggacagcaattcatcgcaagcat
catgcaaagtgtgaaaccaaggaggatccacatagtccggttgtttacggtatcgaaaaa
gtattagcggaaggttcggaactctatagagcagaagctaaaaatgcggagactctgaag
agatatggttatggtacacctgatgattggctggagcgtaatgtgtatagcaggcatagc
gccaaaggcgttgcgcttatgttgattattaatgtgattttatttggtccgattgggatt
actatttgggctgttcaaatgttatgggctcctgtttttgctgcaggtatcattaacggt
gttggtcattattggggatatcgtaattttcaagcggaagatgccagcaaaaatattgtt
ccttggggtattttgattggtggagaggagttacataataatcatcatgcatatgcgaca
tctgcacgcttatcgaataagtggtatgagttcgatatcggttggatgtatattcgaatt
ttggaaatgctggggcttgcaaaagtcaaaaaggttgcgcctaaattacgtattgatcag
gcgaaaactcaatgtgattcagataccttacaagctgttatttctcatcgatatgaagtt
cttgcaaagtatacgaaatcattaaaagcaacttttgcaaaggagatgattcatttgaaa
gaagcaacaattcactatggagtggacagttctactttaaagcgctgggttctggccgat
tctaaaaccttgcaagatcatgagcgcgagaagctgacccaagtgctcagtaacgctaaa
actctcgataaagtctatactatgcgagatgagttagctcagatatggcaaagatctact
gccacaacggaagaattggttaaacaattggaagattggtgtcgacgtgcggaggagagt
ggaattgaagtactgagagtattttctcagcgactacggtgttatgcttga

DBGET integrated database retrieval system