KEGG   Nitrosomonas sp. AL212: NAL212_1581Help
Entry
NAL212_1581       CDS       T01443                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00010  Glycolysis / Gluconeogenesis
nit00020  Citrate cycle (TCA cycle)
nit00620  Pyruvate metabolism
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01120  Microbial metabolism in diverse environments
nit01130  Biosynthesis of antibiotics
nit01200  Carbon metabolism
Module
nit_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_1581
   00020 Citrate cycle (TCA cycle)
    NAL212_1581
   00620 Pyruvate metabolism
    NAL212_1581
Enzymes [BR:nit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NAL212_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ADZ26462
JGI: NAL212_1581
UniProt: F9ZJS6
Position
1523707..1525017
Genome map
AA seq 436 aa AA seqDB search
MAELRKVFIPDIGDFKDVPVIEILIKAGDAVKTEDSLITLESDKATIEIPSPFSGLIREI
FVKSGDKVSEGTAILTIEDSGDTQSEPLPQTAAEENADKNVVEVTPEVGVKPDNVQSVQN
TPQPISTRDDISSRAHASPSIRRFARELGVNLELVTGSGPKQRILKEDVQAHVKTELSKS
GNKSSGTVFNLPPWPEVNFAKYGPVESRSLTRIKQISGANLHRNWVMIPHVTQFDQADIT
DLEALRKKSNENQNATKFKLTLLAFVMKALIAPLKKFPEFNASLDNYADERASLIIKHYY
HIGFAVDTINGLVVPVIKDVDQKGIFAIAEELTRLSSLAREGKLKPADMQGASFTISSLG
GIGGTAFTPIINAPEVAILGISKADIKPVYQNLQFIPRLILPLSLSYDHRVIDGAAAARF
TTHLSEVLTDMRLALL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaattaagaaaagttttcattcctgatatcggagatttcaaagatgttcctgtt
attgagatcttaattaaagcgggcgatgctgttaaaacagaggattcgcttattacactg
gaatctgacaaggccacaatcgagattccatcacctttcagtggcttgatcagggaaatt
tttgtcaaatccggggataaagtatcggagggcacggcaatcttaaccatcgaagattct
ggtgatacccaaagtgagccgctacctcaaaccgcagcggaagaaaacgctgacaagaat
gttgtcgaagttacgcctgaagttggagttaaaccggataatgttcaatcagtacaaaac
acgccacaaccgatatccactagagatgatatttcttccagagcgcatgccagtccatca
attcgccgctttgcacgggagctgggagttaatctggagttagttacaggaagcggtcct
aaacagcgtatcctgaaagaagatgtgcaagcccatgtaaaaacggaattatcgaaatcc
ggaaataaaagctcaggaacggtatttaatttgccgccgtggcctgaagtcaatttcgct
aaatatggtcctgttgaatcaagaagcctgacacgcatcaaacaaatctctggcgccaac
ttacatcgcaattgggtaatgattccgcatgtcactcagttcgatcaagcggatattact
gatttagaagcgttgcgaaaaaaatccaacgagaatcaaaatgccactaaatttaaattg
actttgttggcatttgtgatgaaggcattgatcgcgccgctaaagaaatttccggagttt
aatgcatcactcgataattatgcagatgaaagggctagcttaattatcaaacattattat
catatcggctttgcagtggatacaatcaatggattagttgtgcctgtaataaaagacgtt
gatcaaaagggaatttttgctattgccgaggaactaacccgactatcttcattggcacgc
gaaggcaaattgaagcccgctgatatgcagggcgccagtttcaccatatcaagtctgggg
ggaattggcggaacagcatttacacccattatcaatgctcccgaagttgccattctggga
atctcaaaggccgatattaaaccggtttatcaaaacctccagtttatccctcgtttgata
cttccgctgtcgctttcctacgatcatcgtgtcattgatggcgccgctgcagcgcgtttc
actacgcatttgtctgaggtattgacagatatgcggcttgctttactatga

DBGET integrated database retrieval system