KEGG   Nitrosomonas sp. AL212: NAL212_1613Help
Entry
NAL212_1613       CDS       T01443                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NAL212_1613
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_1613
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NAL212_1613
Enzymes [BR:nit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NAL212_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1559186..1560604
Genome map
AA seq 472 aa AA seqDB search
MRYISTRGGMSQKSFSEILLSGLAPDGGLAMPEIYPKVTMAELDAWRNLSYPSLAFEILS
RFADDIPMDDLRNLISQTYTPEVFGSVDITPLRTLEPGLHILGLSNGPTLAFKDIAMQLL
GNLFQYQLAKTGDELNILGATSGDTGSSAEYAMRGKHGIRVFMLSPLGKMSRFQTAQMFS
LQDKNIFNIAIRGVFDDCQDIVKAVSNDHAFKLAHRIGTVNSINWARIVAQVVYYFKGYF
AATENNDEQVSFAVPSGNFGNICAGHVARMMGLPIKHLILATNENDVLDEFFRTGVYRPR
TTAETRHTSSPSMDISKASNFERFIFDLTDRNAEQVTEFWSKVDQGNAFDLSITPLFSKV
KDYGFVSGSSSHAARIETIRDIYQRYHVLIDTHTADGLKVGQAHREAGVPLICLETALPA
KFSESITEAIGCEPELPVGFENLQSLPQRYVVKEADVQAIKEYIDQQCKIPA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatatttctactcgcggcggaatgtcgcagaaatctttttctgaaattcttttg
agcggtttagcgcccgatggcggattggcgatgccggagatctatcccaaagttacaatg
gcagaactggatgcttggcgaaacttgagttatccctcgcttgcattcgaaattttgtca
cggtttgcggatgatattccgatggatgatctgcgcaatctgatcagccagacgtatact
cccgaggttttcggcagcgtggatattacgccattaaggaccttggagccgggtttacat
attttgggattatccaatggaccgactctggcgttcaaggatatcgcgatgcaattgctc
ggtaatttatttcaatatcaattggccaaaactggggatgaattgaatattctcggtgcg
acatcgggggataccggttccagtgccgaatatgccatgcgcggcaagcacggcattcgc
gtttttatgttatccccattggggaaaatgagccgctttcaaactgcgcaaatgttttcg
ctgcaggataagaatattttcaacatcgcgattcgcggcgtgttcgacgactgccaggat
atcgtcaaggccgtcagcaacgatcatgccttcaaactggcgcaccgtatcggcacggtc
aattcgattaactgggcacgcatcgtggcgcaagtagtgtattatttcaaagggtatttt
gccgcgaccgaaaataatgacgaacaggtttcatttgcagttccgtccgggaatttcggt
aatatttgtgccgggcacgtggcgcgaatgatggggttgcctatcaaacatttaattctg
gcaaccaatgagaacgacgtactggatgagtttttccgaaccggcgtttatcgtccacgt
accaccgcggaaacccggcataccagcagtccatcgatggatatttccaaagcctccaac
ttcgaacgttttatttttgacttgactgacagaaacgcggagcaggtgactgaattctgg
tcaaaagtcgaccaaggcaacgcctttgatctatccatcacaccattattttctaaagtc
aaggactacggttttgtttccggaagcagcagccatgccgcgcggattgaaactattcgg
gatatttaccagcgttatcacgtgctgatcgatacccataccgcagatggtttgaaagtg
ggacaagcacatcgcgaggcgggtgtgccattgatttgtctggaaaccgccttgcctgcc
aaattttctgaaagtatcacggaagccattggttgcgagccggaactccccgtcggcttc
gagaatctgcaaagtcttccgcagcggtatgtggttaaagaggcggatgtgcaagcgatc
aaggaatatattgatcagcaatgtaagatacctgcgtag

DBGET integrated database retrieval system