KEGG   Nitrosomonas sp. AL212: NAL212_1781Help
Entry
NAL212_1781       CDS       T01443                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAL212_1781
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAL212_1781
  Amino acid metabolism
   00310 Lysine degradation
    NAL212_1781
Enzymes [BR:nit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NAL212_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1731022..1732287)
Genome map
AA seq 421 aa AA seqDB search
MLVEVKVPVLSESVADATLISWHKKTGDQVNRSENLIDIETDKVVLELPAPSAGVLTKVL
KNDGATVTSGEVIAMIETEATGVADVQPPQPDSQSASVTEKETSIATEKNTENSDIEDSN
QAIPMLMPAARKLAEENNLKTTETSAIKGSGLGGRIIKEDVQAYMDRKSSISLEIESKPE
ATVTSKAGTRTERRVAMSRLRQRIAERLIESQSTAAILTTFNEVNMQAIIDLRTRYRAEF
EKEYGVKLGFMSFFIKAVIAALKKYPVINASVEGNEIIYHDFYDIGIAVGSPRGLVVPII
RDADRLTLAEIELQIADFAKRAQDGKLTIEELSGGTFSITNGGVFGSMLSTPIINPPQSA
ILGIHATKERPVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKEALEYPMSPLLE
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttagttgaagtcaaagtacccgtgttatctgaatctgtagctgatgctacactcatt
tcctggcataaaaaaacaggcgaccaagtcaatcgatcggaaaacttgatcgatatagaa
accgacaaggtcgtgctggaattacctgctcctagtgcgggtgtattgaccaaagtgctg
aaaaatgatggggctaccgttaccagtggtgaagtgattgcaatgattgaaaccgaggct
actggagttgccgacgttcagccgcctcaaccggatagtcagtcggcttccgtcactgaa
aaagaaacatcaattgctaccgagaaaaatacagaaaattctgatattgaagatagcaat
caagcaatacccatgttgatgccggcggcgcgtaaactagcggaagaaaacaatttgaaa
actacggaaacttctgcaattaaaggcagtggtttgggagggcgtataatcaaggaggat
gtgcaagcctatatggaccgcaaatccagcatatccctggaaattgaatccaaacctgag
gccaccgttacatctaaggctgggacgcgtactgaacgcagagttgccatgtcacggctg
cggcaacgtattgcggaacgtttaatagaatcacaatctaccgcagcgattttgaccacc
ttcaatgaagttaacatgcaggcgatcatagatttgcgtacccgctatagagctgaattt
gagaaggaatatggcgtaaaactgggttttatgtcgttcttcatcaaagcggttattgct
gcgcttaagaaatatccggttatcaacgcctcggtcgagggcaatgaaattatctatcac
gacttctacgatatcggcatcgctgtcggcagtccacgggggctggtggtaccgatcatc
cgcgatgcagatcgtttgacactggcggaaattgagttgcagattgctgattttgccaag
cgtgctcaggatggtaaattgaccattgaagaacttagcggcggcactttttcgatcacc
aatggtggtgtgtttggctccatgctatcaacgcctatcattaatccgccacaaagcgct
attcttggtattcatgccacaaaggaaagaccagtggtagagaatgggcaaattgtgatc
cgcccaatgaattacctcgcgttgtcctatgatcatcgaattatcgatggcagggaagcg
gtattatcgctggtagcaatgaaagaggcgttggaatatccgatgagtccattgctggaa
aaataa

DBGET integrated database retrieval system