KEGG   Nitrosomonas sp. AL212: NAL212_1830Help
Entry
NAL212_1830       CDS       T01443                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NAL212_1830
   00052 Galactose metabolism
    NAL212_1830
   00500 Starch and sucrose metabolism
    NAL212_1830
   00520 Amino sugar and nucleotide sugar metabolism
    NAL212_1830
Enzymes [BR:nit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NAL212_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1783804..1784685)
Genome map
AA seq 293 aa AA seqDB search
MKAIRKAVFPVAGLGTCFLPATKANPKEMLPIVDKPLIQFAAEEAVAAGIDVLIFIIGRN
KSSIPDHFDKAFELEAKLEEGKKQEMLNVVRNILPSRIDCVYIRQAEALGLGHAVLCAQS
VVGDEPFAVLLADDLINANERCCLSQMTDIYNQNHCSILGIERVPHETVNRYGIIDSMPI
SDKLSKVNAIVEKPAVDLAPSNLAVVGRYILTPRIFKLLEQTERGAGNEIQLTDGIAKLL
KEESVLGYEFQGKRFDCGSKSGYLQATVEFALQHPELKEEFKTYLTDLTKEYS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaataagaaaagctgtatttcctgttgcagggttaggaacctgttttttaccg
gcaaccaaagcgaatcccaaggaaatgctacctatcgttgataagccattaatccagttt
gccgcagaagaagcggttgccgcaggcatcgatgtgttaattttcattattggtcgtaac
aaaagttcaataccggatcattttgacaaagcttttgagttagaagccaagcttgaggag
ggcaaaaagcaggaaatgctcaatgtagtacgcaatattctgccgtcgcgtattgattgt
gtttatatccgccaggcagaagcattgggattggggcacgctgttttatgtgcgcaatct
gtagtcggtgatgagccttttgcagtattgctggcagatgatttgatcaatgcaaatgag
cgatgctgtttgagtcagatgaccgatatctataatcagaatcattgttcaattttgggt
attgaacgggtgccacacgaaacggttaaccgctacggcataatcgatagcatgccaatt
tcagataaattgtccaaagtaaatgccattgttgagaaaccagcggttgatctagcacct
tccaatcttgcagttgtcggacgttatattttgacgccacgaatttttaaacttctggag
caaaccgagcgcggcgccggtaatgaaattcaacttacggatggcattgcaaagctgcta
aaagaagaatctgtactaggttatgaattccaaggcaagcgttttgattgtggcagtaag
tcaggttatctgcaggcaacggtagagtttgcattacaacaccctgagcttaaggaagag
tttaaaacatatttgactgatttaacaaaagaatattcctga

DBGET integrated database retrieval system