KEGG   Nitrosomonas sp. AL212: NAL212_1923Help
Entry
NAL212_1923       CDS       T01443                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00480  Glutathione metabolism
nit00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NAL212_1923
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NAL212_1923
Enzymes [BR:nit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NAL212_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADZ26761
JGI: NAL212_1923
UniProt: F9ZE52
Position
1872693..1873232
Genome map
AA seq 179 aa AA seqDB search
MRILLALILFSLVNSALACNSALLDQNFRKLAASEMVNLCETYAGKVLLVVNTASKCGYT
PQYEELEQLYDKYQSKGLVVLGFPSNDFMGQEPGTEAEIQDFCRLTYDVKFPMFEKTTVK
KGHAHPFYVQLAELSGTYPTWNFQKYLIGRDGQFIVQFSPHTKPSDLAVVTAIEQALRQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctactcgctttaatcctgttttctctagtgaattccgctcttgcctgtaac
agtgcacttttggaccagaattttcgtaagcttgcagcatcggagatggtgaatttatgc
gaaacctacgccggcaaagtgctactcgttgtaaataccgccagcaaatgcggctacaca
ccgcagtatgaagagttggaacaactgtatgataaatatcaatccaaaggattggtcgta
ctgggtttcccatccaatgattttatgggacaggaacctggaaccgaagctgaaattcaa
gatttctgccgcttgacttacgatgtaaaattcccgatgtttgagaaaaccacggtaaaa
aaaggccatgcacatccattttatgttcaattggctgaattatccggcacctatccgacc
tggaatttccaaaaatatttaatcggccgcgacggccaattcatcgttcaattcagtccg
cacaccaagccttccgacctggctgtagtgacagcaatcgaacaagcgctaagacaataa

DBGET integrated database retrieval system