KEGG   Nitrosomonas sp. AL212: NAL212_1923Help
Entry
NAL212_1923       CDS       T01443                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NAL212_1923
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NAL212_1923
Enzymes [BR:nit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NAL212_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1872693..1873232
Genome map
AA seq 179 aa AA seqDB search
MRILLALILFSLVNSALACNSALLDQNFRKLAASEMVNLCETYAGKVLLVVNTASKCGYT
PQYEELEQLYDKYQSKGLVVLGFPSNDFMGQEPGTEAEIQDFCRLTYDVKFPMFEKTTVK
KGHAHPFYVQLAELSGTYPTWNFQKYLIGRDGQFIVQFSPHTKPSDLAVVTAIEQALRQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattctactcgctttaatcctgttttctctagtgaattccgctcttgcctgtaac
agtgcacttttggaccagaattttcgtaagcttgcagcatcggagatggtgaatttatgc
gaaacctacgccggcaaagtgctactcgttgtaaataccgccagcaaatgcggctacaca
ccgcagtatgaagagttggaacaactgtatgataaatatcaatccaaaggattggtcgta
ctgggtttcccatccaatgattttatgggacaggaacctggaaccgaagctgaaattcaa
gatttctgccgcttgacttacgatgtaaaattcccgatgtttgagaaaaccacggtaaaa
aaaggccatgcacatccattttatgttcaattggctgaattatccggcacctatccgacc
tggaatttccaaaaatatttaatcggccgcgacggccaattcatcgttcaattcagtccg
cacaccaagccttccgacctggctgtagtgacagcaatcgaacaagcgctaagacaataa

DBGET integrated database retrieval system