KEGG   Nitrosomonas sp. AL212: NAL212_2001Help
Entry
NAL212_2001       CDS       T01443                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nit  Nitrosomonas sp. AL212
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAL212_2001
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAL212_2001
   00650 Butanoate metabolism
    NAL212_2001
  Energy metabolism
   00190 Oxidative phosphorylation
    NAL212_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1954395..1954748)
Genome map
AA seq 117 aa AA seqDB search
MVRQSGLAVTGAHYGSRDWLLQRVTAILMIIYLIVLVSVLCVAAPQNYAEWKGLFQLQWL
RIATFVFFMGMFWHAWVGVRNVLMDYVHSTPIRLMMHIAVVTALLFYLVWAAEILWS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtgaggcaatccggattggctgtcacgggcgcgcactatggttcgagggattggctg
ctccagcgtgtgaccgccattctgatgataatttatcttattgttctggtcagtgtgttg
tgtgttgcagccccacagaattatgcggaatggaaaggtttattccagcttcaatggctg
cgcatcgcaacttttgtgttttttatgggtatgttctggcatgcatgggtgggtgtgcgc
aacgtcctgatggattatgttcattccacaccgattcgcttaatgatgcatatcgcggtg
gtgactgctttgctgttttatctggtttgggctgcggaaatattgtggagttaa

DBGET integrated database retrieval system