KEGG   Nitrosomonas sp. AL212: NAL212_2292Help
Entry
NAL212_2292       CDS       T01443                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NAL212_2292
  Amino acid metabolism
   00300 Lysine biosynthesis
    NAL212_2292
Enzymes [BR:nit01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NAL212_2292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2275593..2276795
Genome map
AA seq 400 aa AA seqDB search
MPNDTLELAQTLIARRSLTPDDDGCQQILIDHLEKLGFHIEKMRFGNVDNLWARRGNTAP
LLCFAGHTDVVPTGPLEQWDSDPFNPTIRDGRLYGRGAADMKSSLAAFITAIEAFLAQHA
DHQGSIALLITSDEEGVAIDGTAKVVETLKARGELLDYCIVGEPTCTDKLGDTIKNGRRG
SLSGNLTIKGIQGHIAYPHLAKNPIHLAAPVIAELAHTEWDQGNEFFPPTTWHISNINAG
TGATNVIPGTLNLLFNFRFSTANTVESLTTKVQETLDKHGLDYELQWELSGKPYLTPKAE
LADAISAAITKVTAVEPQLSTSGGTSDGRFIADICSQVVEFGPRNATIHKLNEYVDVDDL
DQLSRIYLLTMENLLSSKKETTQTHSSSFLDKLKKYFSFE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgacacactggaactcgcacaaacactgattgcccgccggtcactcactcct
gatgatgatgggtgtcagcaaattttaatcgatcatctggaaaaactcggcttccatatt
gaaaaaatgcgtttcggcaatgtcgataatctttgggcccgacgcggcaacacagcaccc
ctgctttgcttcgccggacatactgatgttgtgcccaccgggccattggaacaatgggac
agcgatccattcaaccccactatccgcgatggacgcttatacggacgcggtgctgctgat
atgaaatcatcattggcagcctttattaccgcgattgaagcttttctggcccagcatgcc
gaccatcaaggatccatcgcattattgatcacttcagatgaggaaggcgtggcgatcgat
ggtaccgctaaagtagtcgaaacgcttaaagcgcgcggtgagttactcgattattgtatc
gtgggcgaaccgacgtgcacagacaaactgggcgatacgatcaaaaacggccgccgcggc
tccttatccggaaacctgaccatcaaaggcatacaaggacatatcgcctatccgcattta
gccaaaaacccgatccatctggctgctccggtgattgctgaactggcacatacggaatgg
gatcagggcaatgaattttttcccccgacaacttggcatatttccaatatcaatgctgga
acaggtgccaccaatgtgattcccggcaccctgaatttattgtttaatttccgtttctcc
accgccaacacggttgaatcgctcacaaccaaagtgcaagaaaccctcgataaacatgga
ctggattatgaattacagtgggaactctcagggaaaccgtatctcacgcccaaagccgaa
ttagccgacgcgataagtgccgccattaccaaagtcaccgctgtggagccacaattgtcc
acctcaggaggcacttcggatggccggtttattgcagatatctgctcccaggtggttgaa
tttggtccgcgtaacgcgaccattcacaaactgaatgagtatgtcgatgtcgatgacctt
gaccaactctcgcggatttatctgttgaccatggaaaatttattatcttcgaaaaaggaa
acaactcaaacccattcaagcagcttcctcgataagctgaagaagtatttttcttttgaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system