KEGG   Nitrosomonas sp. AL212: NAL212_2357Help
Entry
NAL212_2357       CDS       T01443                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nit00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2341010..2341918)
Genome map
AA seq 302 aa AA seqDB search
MTIEELNTKHKIADQLEFIAGNGGLPMIRVNNAKAAALISLHAGQVLSYQPAGEPEDVLF
LSEKAYYQEGKAIKGGAPICWPWFGADPEGKGRPGHGFVRNRAWNVVATEAMGNGDVKVT
LGLMDTPDTRAIWPQSFNLWQEIVIGDTLNLSLITRNTGKETFSITQAFHTYFKVGDIAR
TKVLGLEGCEYIDKAGGGNTQKHQTGNVTIDAEVDRIYLNVGNTLNIDDSALNRHIQITS
QGSKTAVVWNPWEKIAKDMADLEDADYKHLLCVETTNAADDVREVAPGGECRLVANYRVV
RG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgaagaactcaataccaagcacaaaattgcagatcaacttgaatttatagcc
ggtaacggcggattgccgatgatccgggtgaataatgccaaggccgcggcgttgatttcg
cttcatgccggacaggtgttgtcataccagccagccggagaaccggaagatgttctgttc
ctgagtgaaaaagcatattaccaggagggcaaagcaattaaaggcggtgcgccgatctgc
tggccgtggtttggtgccgatccggaaggcaagggtcgtcctgggcatggatttgtacgt
aatcgtgcgtggaatgtcgtggccaccgaagctatgggcaatggtgatgtcaaagtcacg
ctgggcttgatggatacaccggatacgcgtgccatctggccgcaatcgttcaatctgtgg
caagaaattgtaattggcgataccttgaatctgtccctgatcacgcgcaataccggaaaa
gaaacattctccattacacaagcgtttcatacctactttaaagtgggtgatatcgcacgg
acgaaagtgcttgggttggaaggttgtgagtatatcgacaaagccggtggcggcaacacg
caaaaacatcagacgggcaatgtcaccatcgacgccgaagtcgaccgcatctatctaaat
gtcggcaacaccctgaacatcgacgacagcgcactcaaccggcacatccaaatcacttcg
caaggcagcaaaaccgctgtggtatggaatccctgggagaaaatcgccaaggacatggcg
gatttggaagatgccgattacaagcatttgctgtgtgttgaaaccaccaatgcggcggat
gatgttcgggaagttgcgccgggtggggagtgccggttggtggctaattatcgggtggta
cgcggttaa

DBGET integrated database retrieval system