KEGG   Nitrosomonas sp. AL212: NAL212_2629Help
Entry
NAL212_2629       CDS       T01443                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nit00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2589860..2591335)
Genome map
AA seq 491 aa AA seqDB search
MIVAIALDLGTTSIKAALMDHQGILWNIVTHPAPAIDSCDGRYESNALQYAAVAEQVLKE
CLAQTQTQTQTQTQTQTQTQTQTQTQTQTQTQAQNNPPLGLCSQRSSFLLWDKTTGKPVT
PLISWQDDRGASCCDRLQMSSNTIHKLTGLRLTPYYLGPKVSVLLQENPAWREKLIQGEW
LVGTLDTFLIWLWTGKQHFITDASMAARTLLMDIHQQQWSDVLCDFFDVPRSILPQIRPS
AGLDLTLDNGLILQASVGDQSAALIASLANNQSEALVNLGTGGFVIRSTAKRKVAFNGYL
QTLVYQNRSRQVQFAIEGTLNSIASALAPYPVNECCIEDLACNDIFCLAEPSGLGAPYFR
NDWGIHFSQPVTGFAPRQIALLLLEAIIFRVARILEEFHQHAPLTQVYLSGGLSELLCLQ
YGIAQCVIFPVYYLQQKEASLQGTAALACGVKATYHWEVQKIENKQTGIALMKKYRRWKE
WLDALLSTSHG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgatagtggcgatcgcactcgatttgggtacgacatccatcaaagcagctttgatggat
catcaaggaatactctggaacattgtcacccacccggcgcctgctatcgacagctgcgat
gggcgatacgaaagcaatgcattgcagtatgctgccgttgctgaacaggttctcaaagaa
tgccttgcccaaactcaaactcaaactcaaacccaaacccaaacccaaacccaaacccaa
acccaaacccaaacccaaacccaaacccaaacccaagctcagaacaatccaccgctggga
ttgtgcagtcaacgttcgtcttttttactctgggataaaaccaccggtaaaccggtaacg
ccattaatttcgtggcaagatgaccgtggcgcaagttgttgcgaccgtctgcagatgtcc
tcaaataccattcacaaacttaccggcttacgtctaacgccttattatctggggcctaag
gtgagtgtactgttgcaggaaaacccggcatggcgggagaagcttattcaaggtgaatgg
ctggtgggtacattggatacgtttctgatttggctttggaccggcaagcagcactttatc
accgatgcatcaatggccgcgcgcacgctgctgatggatattcatcagcagcagtggtca
gatgttttatgtgactttttcgatgttcctcgttcgattttgccgcaaatcagaccttca
gccggattggatctcactttagacaatggattaatcttacaagctagcgtcggcgatcaa
tcggcggcgttgattgccagtttggcaaataatcagagcgaagctttggttaatctgggg
acgggtggttttgtgattcgttcgactgccaagagaaaagtagcgtttaatggatattta
caaacattggtttatcaaaacagaagccgacaagtacaatttgctatcgaagggacgctt
aattccatcgcctcagcgcttgcgccttacccggtcaatgaatgttgcatcgaagatctg
gcgtgcaacgatattttctgcttggcagaacctagtggcttgggtgcgccttattttcgc
aacgattggggcattcatttttctcagccggtcaccggctttgccccacgacaaattgct
ttactgttgctcgaagcgattattttccgggttgcgcgtatcctggaagagtttcaccag
catgcgccattaactcaggtttatttatccggcggtttatctgagttactctgtttgcaa
tatggcattgcacaatgtgttatttttccggtttattacttgcagcagaaggaagccagt
ctgcaaggtaccgctgcattggcctgtggagttaaagcaacctatcattgggaggtgcaa
aaaatagaaaataagcaaacaggcatcgcactcatgaaaaagtatcggcgttggaaagaa
tggctggatgctttattaagtacctcgcacggttaa

DBGET integrated database retrieval system