KEGG   Nitrosomonas sp. AL212: NAL212_2743Help
Entry
NAL212_2743       CDS       T01443                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAL212_2743
   01230 Biosynthesis of amino acids
    NAL212_2743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_2743
   00051 Fructose and mannose metabolism
    NAL212_2743
   00562 Inositol phosphate metabolism
    NAL212_2743
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NAL212_2743
Enzymes [BR:nit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NAL212_2743
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NAL212_2743
  Exosomal proteins of bladder cancer cells
   NAL212_2743
  Exosomal proteins of melanoma cells
   NAL212_2743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2704347..2705102)
Genome map
AA seq 251 aa AA seqDB search
MRKKMVVGNWKMHGNLLENKQLLDIIVSSLDGLHEDLIAVCVPYLYLPSVQNQLQNSEIA
WGAQNVSQFEKGAYTGEISAPMLSDFRCQYVIVGHSERRMLFGEGNDVVAEKFVAAQHAG
IIPILCVGETLEQREANNTEQVIEQQLTSVINLAGIESFNKAVIAYEPVWAIGTGMTASP
EQAQDVHAFIREGLAKQNSNVAEQVVILYGGSVKGNNASELFAMSDIDGGLIGGASLIAN
DFIAICRALRH
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaagatggttgttggtaattggaagatgcatggtaatttgttagagaataaa
cagctacttgatataatagtctctagtttagatggattgcacgaagatcttattgcagtt
tgtgtgccttacctctatctaccgtctgtacaaaaccaattacagaattcggaaattgca
tggggcgctcagaacgtgagtcaatttgaaaagggtgcatacacaggagaaatttcagcg
ccaatgttgagtgattttaggtgccaatatgttattgtagggcattcggaaagaagaatg
ctctttggtgaaggcaatgatgtggtcgcagaaaaatttgtggcagctcaacacgcagga
ataattccaattttatgcgtcggagaaacactggagcaacgtgaagctaacaatactgag
caggtcattgagcaacagttaacgtcagtcattaatttggcaggaatcgagtcgtttaac
aaagctgtaattgcttatgaaccggtctgggctattggaacaggtatgactgcatcgcca
gaacaagcgcaagatgtgcatgcatttattagggaaggcttagctaagcaaaattcgaac
gtggcagagcaggtggttattctctacggggggagtgtcaaaggtaataatgcctctgag
ctatttgctatgtcagatatcgatggtggcttaataggtggcgcttcgctcattgcaaat
gattttatagcaatttgtcgcgcattacgtcattaa

DBGET integrated database retrieval system