KEGG   Nitrosomonas sp. AL212: NAL212_2752Help
Entry
NAL212_2752       CDS       T01443                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00010  Glycolysis / Gluconeogenesis
nit00260  Glycine, serine and threonine metabolism
nit00680  Methane metabolism
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01120  Microbial metabolism in diverse environments
nit01130  Biosynthesis of antibiotics
nit01200  Carbon metabolism
nit01230  Biosynthesis of amino acids
Module
nit_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_2752
  Energy metabolism
   00680 Methane metabolism
    NAL212_2752
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_2752
Enzymes [BR:nit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAL212_2752
Membrane trafficking [BR:nit04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NAL212_2752
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAL212_2752
  Exosomal proteins of melanoma cells
   NAL212_2752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Med5
Motif
Other DBs
NCBI-ProteinID: ADZ27540
JGI: NAL212_2752
UniProt: F9ZIJ3
Position
2713998..2714747
Genome map
AA seq 249 aa AA seqDB search
MKKIVLLRHGESTWNQENRFTGWTDVDLTPNGIQEAQNAGQLLREHGFTFDIGYTSVLKR
AIRTLWIVLDKMDQMWIPIEHTWRLNERHYGALQGLNKIEIATQYGDEQVLIWRRSYDVR
PPALNINDQRYAGTDLRYKNLARNDIPLTECLKDTVTRFLPYWNTTIAPQIQADKSVIIA
AHGNSLRALVKYLDNVSDNDILNCNIPTGIPLVYELDDNLKPIRNYYLGNPTDIQKAMKI
VANQGKLVG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttctcctacgccacggagaaagtacttggaatcaagaaaatcgattt
acgggttggacagatgttgatttaaccccaaatggcattcaagaagctcaaaatgccgga
cagcttttacgcgaacatggatttacatttgatatcggctacacatccgttctcaagcgc
gccattcggactttatggatagtgctggataaaatggatcagatgtggattccaatagag
catacatggcgattgaatgaacgacattatggtgctctgcaaggtcttaataaaattgaa
atagccactcaatacggtgacgaacaagtcctaatttggcggcgaagctatgatgttaga
ccacctgccttgaacattaatgatcaacgttatgcaggcaccgatctgcgctataaaaat
ttagcgcgcaatgatattcctttaactgagtgtcttaaagatacagttacaagattttta
ccctattggaacacaactattgcacctcagatccaggcggataaaagtgtgattattgcc
gcgcatggaaattcgttaagagcgctggtcaaatatttagataatgtttccgacaatgat
atactcaattgcaacattcctaccggtattccgctagtatatgagctggatgataattta
aaacccatacggaattattatcttgggaatccaacagatattcagaaagcaatgaagatt
gtagctaaccaaggaaaattagttggttaa

DBGET integrated database retrieval system