KEGG   Nitrosomonas sp. AL212: NAL212_2770Help
Entry
NAL212_2770       CDS       T01443                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NAL212_2770
Enzymes [BR:nit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NAL212_2770
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NAL212_2770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2732905..2735103
Genome map
AA seq 732 aa AA seqDB search
MTTSKTNLLLHALINAQLHDPYAYLGLHREHNQVLVRVFRAFDTQVWIQTSTGFEPMQCI
HPEGIFEWRSQSMPLMPYRLRVEAKDPRHTIHEVYDPYAFALQLSDHDLYLFNQGKLWQA
YRMLGAQPARNAGVDGMRFAVWAPNAERVSIVGDFNHWNGKMHPMKAHHASGVWELFIPE
LPPNIHYKFEIRNRSSGEILIKTDPYAKQYELRPNTAALIPALSSYHWQDATWMAHRADW
NWLHAPLNILEIHAGSWKRHPDGRFYTYRELAEHLLPYVQEMGYTHIELMPVSEHPLDES
WGYQTTGYFAVTSRFGSPDDFRFFVDACHQMGIGVILDWVPAHFPQDTFALARFDGTALY
EHEDPRLGFHQDWGTYIFNYGRNEVKSFLLSSAHYWLSEFHLDGLRVDAVASMLYLDYSR
KHGEWLSNKHGGRENLEAIDFLRELNIMVHGEFPGALTLAEESTAWPGVSRPTYVGGLGF
SMKWNMGWMHDTLSYMHQNPIYRRYHHEQLTFSQLYAYTENFVLPFSHDEVVHGKGSLWN
KMPGDAWQKFASVRLLLVYQMTCPGKKLNFMGNEFAQQREWRVSHELDWHLLEQQPHAGV
QAAARDLNHCYQNIPALHQLDFTAEGFHWIDCQDADQSIISYMRRAMNGSFVLVVLNFTP
VPRTGYRIGVPAAGIYREIFNSDSTYYGGSNVGNLGNITSVSEPWMGFTDSMAITLPPLA
GVIFSWQELPVD
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagcaaaaccaatcttctgctgcatgcactgatcaatgcacagctccatgac
ccctacgcgtatttaggtctacatagagagcacaatcaagttctggtaagagtattccgt
gcttttgatacgcaggtatggatccaaacatcaactggctttgagccgatgcaatgcatt
catcctgaaggaatttttgaatggcgcagccaatcaatgccgctcatgccataccgcttg
cgcgttgaagcaaaagacccaaggcataccatccatgaagtatatgatccctatgctttt
gcgttgcaactttctgatcatgatttatatttattcaatcaaggtaagctatggcaggct
tatcgcatgcttggagctcaaccggccaggaatgcaggcgttgatggaatgcgcttcgca
gtatgggctccgaatgccgaacgcgtcagcatagtcggtgatttcaatcattggaacggc
aaaatgcacccgatgaaggcgcatcacgccagcggtgtatgggaattgtttattccggaa
ttaccacccaatattcattacaaatttgaaattcgcaatcgcagtagcggtgaaatcctc
atcaagacggacccctatgccaagcaatacgaattgcgtcccaacactgccgcactgatc
cctgcccttagctcctatcattggcaggatgccacctggatggcacacagagctgattgg
aattggttgcatgcaccgctgaatattcttgaaattcacgccgggtcatggaaacgacac
ccggacggacgtttctatacctatcgagaactagcagagcatctattgccttacgtacag
gaaatgggttatacccatatcgaattgatgcccgtctcggaacatcctctggacgaatcc
tggggttaccaaacaacgggatattttgccgtcaccagccgcttcggctcaccggatgat
ttccggtttttcgtagatgcttgtcaccagatgggaatcggcgtgattctggattgggtg
cccgcgcattttcctcaggatacttttgcactggcacgctttgacggtaccgccctatac
gaacatgaggatccgcgcctagggtttcatcaggattggggtacttacatcttcaattat
ggtcgcaatgaagtgaaatcctttcttttgtccagcgctcattattggttgtccgaattt
cacttggatggattgcgtgttgatgcagtggcttcaatgctctatcttgactattcccgc
aagcatggcgaatggttgtcaaataaacatggtggacgggaaaatctggaagcaattgat
ttccttcgtgaactaaatattatggtccatggggaatttcctggcgcactgacactggcg
gaagaatccaccgcctggcctggagtatcacgcccaacttatgtgggggggttgggtttt
tcgatgaaatggaatatgggttggatgcacgatacactatcttacatgcaccaaaatcct
atctaccgacgctatcatcacgagcagctgactttcagccagctttatgcgtataccgaa
aattttgtgctaccgttctcgcatgacgaggtcgtgcatggcaaaggctcgctttggaac
aaaatgcccggagatgcctggcaaaaatttgccagcgtacgcctgctattggtatatcaa
atgacgtgcccaggcaaaaaactcaatttcatgggcaacgaattcgcgcaacaacgcgaa
tggcgcgtgagtcacgaattagattggcatttgctggaacaacaaccgcatgccggcgtg
caagctgctgcgcgcgatttgaatcactgttatcaaaatattccggctttgcatcaactt
gactttaccgctgaaggctttcactggatcgattgccaggatgccgatcaatcaataatc
agctacatgcggcgcgccatgaacggatcatttgttttggtcgttctaaatttcaccccg
gttccacgcactggctatcgcatcggcgtgcccgctgccggtatttatcgggagattttt
aatagcgactccacttattacggtggcagcaatgtcggtaatctaggcaatattaccagc
gtgtcagagccctggatggggtttaccgattcaatggcaattacgctgccaccgttagcg
ggcgtaattttttcttggcaggaattgcccgttgattaa

DBGET integrated database retrieval system