KEGG   Nitrosomonas sp. AL212: NAL212_2884Help
Entry
NAL212_2884       CDS       T01443                                 

Definition
phosphoglycerate mutase family protein (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAL212_2884
   01230 Biosynthesis of amino acids
    NAL212_2884
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_2884
  Energy metabolism
   00680 Methane metabolism
    NAL212_2884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_2884
Enzymes [BR:nit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAL212_2884
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAL212_2884
  Exosomal proteins of melanoma cells
   NAL212_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2868508..2869248
Genome map
AA seq 246 aa AA seqDB search
MPEAIPLQKTSRQNMTKLVLLRHGQSIWNRDKKFTGWSDVALSPKGEQEAEQAAYLLKRA
GFTFDVCFTSVLQRATSTSRIVLAAMHLDIPVLQTWHLNERHYGALEGMGRWPAIKQFGI
WPILGCQIKFDAAPPSLNKGDYRYPGNQSDYASIDRNELPTGESLQQTLVRLKPYWQDTI
QPEIRQGKHVLIVSHRNTLRALMMLLDHLTPAQVMKLKLATGRPVVYELDQQCNASRHYY
VDKLVG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctatcccattgcaaaaaacttctcggcaaaacatgacaaagctggtactg
ctgcgtcatggacaaagtatctggaatcgtgacaaaaaattcaccggctggagcgatgta
gcactgagcccaaaaggtgaacaggaagctgaacaagcggcctacttgctgaaacgcgca
ggctttacatttgatgtgtgttttacttccgtattacaacgcgccacatcaacttcacgc
attgtcctggcggctatgcacctggatattccggtgctgcaaacctggcatttaaacgag
cggcattatggggcactggaaggcatgggacgttggccggcgatcaagcaattcggcatt
tggccgattctgggctgtcaaatcaaatttgacgccgccccccccagcctgaataaagga
gattaccgttatcccggtaatcaatccgattatgcctctattgatcgcaatgaactgcca
acgggggagagtttgcaacaaacccttgtgcgcctcaaaccttattggcaggatacgatt
caaccggaaatccggcaaggaaaacacgtgctgatcgtctctcatcgcaacaccctgcgc
gcattgatgatgctgctggatcatcttacacccgcacaagtcatgaagttgaaactggct
accggtcgacccgtggtgtatgaactggatcaacaatgcaatgcctcgcggcattattac
gtcgacaagctggttggatag

DBGET integrated database retrieval system