KEGG   Nitrosomonas sp. AL212: NAL212_2884Help
Entry
NAL212_2884       CDS       T01443                                 

Definition
phosphoglycerate mutase family protein (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NAL212_2884
   01230 Biosynthesis of amino acids
    NAL212_2884
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NAL212_2884
  Energy metabolism
   00680 Methane metabolism
    NAL212_2884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NAL212_2884
Enzymes [BR:nit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NAL212_2884
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NAL212_2884
  Exosomal proteins of melanoma cells
   NAL212_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2868508..2869248
Genome map
AA seq 246 aa AA seqDB search
MPEAIPLQKTSRQNMTKLVLLRHGQSIWNRDKKFTGWSDVALSPKGEQEAEQAAYLLKRA
GFTFDVCFTSVLQRATSTSRIVLAAMHLDIPVLQTWHLNERHYGALEGMGRWPAIKQFGI
WPILGCQIKFDAAPPSLNKGDYRYPGNQSDYASIDRNELPTGESLQQTLVRLKPYWQDTI
QPEIRQGKHVLIVSHRNTLRALMMLLDHLTPAQVMKLKLATGRPVVYELDQQCNASRHYY
VDKLVG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctatcccattgcaaaaaacttctcggcaaaacatgacaaagctggtactg
ctgcgtcatggacaaagtatctggaatcgtgacaaaaaattcaccggctggagcgatgta
gcactgagcccaaaaggtgaacaggaagctgaacaagcggcctacttgctgaaacgcgca
ggctttacatttgatgtgtgttttacttccgtattacaacgcgccacatcaacttcacgc
attgtcctggcggctatgcacctggatattccggtgctgcaaacctggcatttaaacgag
cggcattatggggcactggaaggcatgggacgttggccggcgatcaagcaattcggcatt
tggccgattctgggctgtcaaatcaaatttgacgccgccccccccagcctgaataaagga
gattaccgttatcccggtaatcaatccgattatgcctctattgatcgcaatgaactgcca
acgggggagagtttgcaacaaacccttgtgcgcctcaaaccttattggcaggatacgatt
caaccggaaatccggcaaggaaaacacgtgctgatcgtctctcatcgcaacaccctgcgc
gcattgatgatgctgctggatcatcttacacccgcacaagtcatgaagttgaaactggct
accggtcgacccgtggtgtatgaactggatcaacaatgcaatgcctcgcggcattattac
gtcgacaagctggttggatag

DBGET integrated database retrieval system