KEGG   Nitrosomonas sp. AL212: NAL212_3193Help
Entry
NAL212_3193       CDS       T01443                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nit  Nitrosomonas sp. AL212
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAL212_3193
Enzymes [BR:nit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NAL212_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3178343..3178831
Genome map
AA seq 162 aa AA seqDB search
MEKGLVFIALGSNLETPISQIQRAFNELGRLADTQLIKHSALYRSAPVGRLDQPDFINAV
AQIKTGLAPLDLLSALLAIEHQQGRVRESLNAPRTLDLDILLYDALQCNDAGLIIPHPRM
IHRAFVLQPLIEIAPDCQIPGYGPIAPLLAACKDQELLKINS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggactggtttttatcgccctgggaagtaatctggaaactccgatttctcag
atacaacgcgcttttaatgaattggggcggcttgctgacacacaactcataaaacactcg
gcgttgtatcgaagtgcaccggtcggacggctggaccaaccggatttcatcaacgctgta
gcgcagatcaagaccgggcttgcaccattggatttactgtctgcgttgctcgctatcgaa
caccaacaggggcgcgtgcgtgaatcgttgaatgcgccacgcaccctggatctcgatata
ctgctgtatgatgcactgcaatgcaacgatgccggattgatcataccgcatccacgtatg
atccaccgcgcatttgtactgcaacccctgatagaaatcgctccggattgtcagatcccg
ggatatggccccattgcacccttacttgccgcatgtaaagatcaagaactattaaaaatc
aactcataa

DBGET integrated database retrieval system