KEGG   Niastella koreensis: Niako_0070Help
Entry
Niako_0070        CDS       T01679                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nko  Niastella koreensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Niako_0070
Enzymes [BR:nko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Niako_0070
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Niako_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74812..76296
Genome map
AA seq 494 aa AA seqDB search
MSKQQYVLAIDQGTSSTKTIIFNEQGKVVARGQEPLQTNYGANGFVEQDPEGIVQNVLAS
VKHCLENFASQQLDVWAIKAIGISNQRETFVVWDKSGKPLYNAVVWQCKRSVEICERLKP
LPIADDIRTKTGLLVDPYFSGTKLVWLYENVAEVKQAIDKGEAYFGTIDTWLLYKFTNGQ
SYYTDHTNASRTLFFNIATLDWDADLLKAFNLQTLNLPRCVPASFMFGETNLLGVLENVI
PITGMIGDSHAAAFGQACLEPGSAKATLGTGCSVMMNIGDKPKASSTGMVTTICWSTGQQ
VCYALEGVIVTCGATIEWLKNEWELFNDSRDTEAMAMAIEDNQGVYLIPAFSGLGAPYWE
MNRKASIHGLTFATTKNHLVRAALETIPYQIKDVIGAMETDAGLLLNQLMVDGGITGNRF
VVQFLANQLNRKVVISGFPEVSALGAAYMAGLKAGVYTGLQQLQQLKVIKDTLVPADVER
NKVWYQGWKKAIGS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaacagtatgtattagctattgaccagggaaccagcagtaccaaaaccatt
atttttaatgagcaggggaaagtggtggcgcgtggtcaggagcctttgcaaacgaattat
ggcgccaatggttttgtggagcaggaccccgagggtattgtacaaaacgtgctggcatcg
gtaaaacattgcctggaaaattttgccagtcagcagttggatgtgtgggccatcaaagcc
atcggcatcagcaaccagcgcgaaacatttgttgtatgggataagagcggcaaaccattg
tataacgccgtggtatggcaatgtaagcggtcggtagaaatttgtgagcggttaaaacca
ttgcccattgccgatgatatccgcacaaaaaccggtttactggttgatccctatttctcg
ggcaccaaactggtttggttgtatgaaaatgtagccgaagtaaaacaggccatcgataaa
ggggaagcttattttggcaccatcgatacctggttgttgtataaattcacgaacggacaa
agctattacaccgatcatacaaacgcctcccgcacgttgtttttcaacatcgccaccctc
gattgggatgccgatctgttgaaagcattcaacctgcaaaccctcaacctgccgcgttgt
gtgcctgcttcctttatgtttggtgaaaccaacctgctgggcgtgctggagaatgtcatt
cccatcaccgggatgatcggcgattcacacgcagctgcctttggccaggcctgtcttgaa
cccggttcggccaaagccacgctgggcacaggttgttcggtaatgatgaacatcggcgat
aaacccaaagcctcttctaccggcatggtgaccaccatttgctggagcaccgggcaacag
gtttgttatgcgctggaaggcgtgatcgttacctgcggcgctaccattgaatggttgaag
aacgaatgggaattgtttaacgacagccgcgatactgaagccatggctatggccatcgaa
gataaccagggcgtatacctgatacctgcgttcagcggtttgggcgctccctattgggaa
atgaaccgcaaggccagcattcatggcctcacctttgccactaccaaaaatcatttggtg
cgtgctgccctggaaactattccctaccagataaaagacgttattggcgccatggaaacc
gatgccggcttattattaaaccagttaatggttgatggcggtattaccggtaatcgtttt
gtagtacagttcctggccaaccagctaaaccgtaaggttgttatcagcggttttcctgaa
gtctccgccctgggcgcggcatatatggcggggttgaaagcaggggtgtatacagggttg
cagcaattacagcagttgaaggttattaaagatacattggttcctgcagatgtggagagg
aataaagtgtggtatcaaggttggaaaaaagctattggttcttag

DBGET integrated database retrieval system