KEGG   Niastella koreensis: Niako_0116Help
Entry
Niako_0116        CDS       T01679                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nko  Niastella koreensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_0116
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Niako_0116
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Niako_0116
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Niako_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140905..142206
Genome map
AA seq 433 aa AA seqDB search
MKYYSLNKQSPDVDFKEATIKGQAPDKGLYFPESIPVQEKAFFENIAQYSNEEIAFRLIQ
PYVAGTIADAALQGIVKETINFPIPLVPVNDRISSLELFHGPTLAFKDVGARFMSRCLGH
FAHDRSEKVVVLVATSGDTGGAVAHGFYDVPGVEVVILYPSGKVSSVQEKQLTTLGKNIH
ALEVTGTFDDCQQMVKQAFVDEELTKKIFLTSANSINVARWLPQQFYYVLAWKQWTDKKN
PPVISVPSGNFGNICAGLLAYCSGLPVKHFIAACNANAVVPSYLANGDYQPKKAIATISN
AMDVGNPSNFVRILELFHHKLGDLRKVLTGYSISDDETKAVLKEVYQQYKYLPDPHGAVG
YLALQRYLQQHADDKGMFLETAHPVKFYDVVEPVIGEAVPVPAAIQDQLKLTKQSTVIAP
DYNALKETLLKKY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactacagtctaaataaacaatcccctgatgtagattttaaggaagccaccata
aaaggacaggcgcctgataagggattgtattttccggaaagcattccggtacaggagaag
gctttttttgagaatatagcgcagtatagtaatgaagagatcgctttccggcttatacaa
ccgtatgttgcaggaaccattgcggatgctgccttacagggcattgtaaaagaaactatc
aattttcccattccactggtgccggtgaatgaccggatatcatcactggaattgtttcat
gggccaacgctggcgtttaaagatgtgggcgcccggtttatgagccgttgtttgggtcat
tttgcgcatgaccgcagtgagaaggtagtagtgttggtagccacttctggcgataccggc
ggagcggtggcgcatggtttttatgatgtgcccggggtggaagtggtgatcctgtatccg
tcgggtaaggtaagctcggtacaggaaaaacaactgactacattaggtaagaatattcat
gcgctggaagtaaccggtacttttgatgattgtcagcaaatggtgaagcaggcttttgtg
gatgaggagctgaccaaaaagatcttcttaacatcggccaactccattaatgtggcgcgc
tggctgccacagcagttctattatgtattggcctggaagcaatggaccgataaaaagaac
ccaccggtgatttctgtgcccagtggcaactttgggaacatctgtgccgggttactggct
tattgttccgggttacctgtaaagcattttattgcggcctgcaatgccaatgcggtggtg
ccttcttatttagctaatggcgactatcaaccgaaaaaagccattgctaccatctccaat
gcaatggatgtgggcaaccccagcaattttgtgcgcatcctggaattgttccatcataaa
ctgggcgatctgcggaaggtgttaactggttacagcatttcggacgatgaaacaaaagcg
gtattgaaagaagtatatcagcaatataaatacctgcccgatccgcatggcgctgtgggc
tacctggctttacaacgctatttgcaacagcatgcggatgataaggggatgttcctggaa
actgcgcatcccgtgaagttttatgatgtggtagagccggttattggcgaagcagtgccc
gtgcctgcggctatccaggatcagttgaagctcaccaaacagagcaccgtgatagcaccg
gattataatgcgctgaaggaaactttgctgaagaagtattaa

DBGET integrated database retrieval system