KEGG   Niastella koreensis: Niako_0116Help
Entry
Niako_0116        CDS       T01679                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nko  Niastella koreensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_0116
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Niako_0116
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Niako_0116
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Niako_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140905..142206
Genome map
AA seq 433 aa AA seqDB search
MKYYSLNKQSPDVDFKEATIKGQAPDKGLYFPESIPVQEKAFFENIAQYSNEEIAFRLIQ
PYVAGTIADAALQGIVKETINFPIPLVPVNDRISSLELFHGPTLAFKDVGARFMSRCLGH
FAHDRSEKVVVLVATSGDTGGAVAHGFYDVPGVEVVILYPSGKVSSVQEKQLTTLGKNIH
ALEVTGTFDDCQQMVKQAFVDEELTKKIFLTSANSINVARWLPQQFYYVLAWKQWTDKKN
PPVISVPSGNFGNICAGLLAYCSGLPVKHFIAACNANAVVPSYLANGDYQPKKAIATISN
AMDVGNPSNFVRILELFHHKLGDLRKVLTGYSISDDETKAVLKEVYQQYKYLPDPHGAVG
YLALQRYLQQHADDKGMFLETAHPVKFYDVVEPVIGEAVPVPAAIQDQLKLTKQSTVIAP
DYNALKETLLKKY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactacagtctaaataaacaatcccctgatgtagattttaaggaagccaccata
aaaggacaggcgcctgataagggattgtattttccggaaagcattccggtacaggagaag
gctttttttgagaatatagcgcagtatagtaatgaagagatcgctttccggcttatacaa
ccgtatgttgcaggaaccattgcggatgctgccttacagggcattgtaaaagaaactatc
aattttcccattccactggtgccggtgaatgaccggatatcatcactggaattgtttcat
gggccaacgctggcgtttaaagatgtgggcgcccggtttatgagccgttgtttgggtcat
tttgcgcatgaccgcagtgagaaggtagtagtgttggtagccacttctggcgataccggc
ggagcggtggcgcatggtttttatgatgtgcccggggtggaagtggtgatcctgtatccg
tcgggtaaggtaagctcggtacaggaaaaacaactgactacattaggtaagaatattcat
gcgctggaagtaaccggtacttttgatgattgtcagcaaatggtgaagcaggcttttgtg
gatgaggagctgaccaaaaagatcttcttaacatcggccaactccattaatgtggcgcgc
tggctgccacagcagttctattatgtattggcctggaagcaatggaccgataaaaagaac
ccaccggtgatttctgtgcccagtggcaactttgggaacatctgtgccgggttactggct
tattgttccgggttacctgtaaagcattttattgcggcctgcaatgccaatgcggtggtg
ccttcttatttagctaatggcgactatcaaccgaaaaaagccattgctaccatctccaat
gcaatggatgtgggcaaccccagcaattttgtgcgcatcctggaattgttccatcataaa
ctgggcgatctgcggaaggtgttaactggttacagcatttcggacgatgaaacaaaagcg
gtattgaaagaagtatatcagcaatataaatacctgcccgatccgcatggcgctgtgggc
tacctggctttacaacgctatttgcaacagcatgcggatgataaggggatgttcctggaa
actgcgcatcccgtgaagttttatgatgtggtagagccggttattggcgaagcagtgccc
gtgcctgcggctatccaggatcagttgaagctcaccaaacagagcaccgtgatagcaccg
gattataatgcgctgaaggaaactttgctgaagaagtattaa

DBGET integrated database retrieval system