KEGG   Niastella koreensis: Niako_0213Help
Entry
Niako_0213        CDS       T01679                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nko  Niastella koreensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Niako_0213
Enzymes [BR:nko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Niako_0213
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Niako_0213
Lipid biosynthesis proteins [BR:nko01004]
 Fatty acid synthase
  Component type
   Niako_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263884..264594
Genome map
AA seq 236 aa AA seqDB search
MKKFNSTIYMSGKYLFVGMLLLALLGSCGNNADKTNDTGKQKREQLPAQAGKEKAKTIVF
FGNSLTAGYGVDPSEAFPALVQEKIDSLHLPYKVVNAGLSGETTAGGKSRIDWILRQPVD
IFVLELGGNDGLRGIPIAETSRNLQAIISRVREKNPQVKIVLAGMQVPPNMGRTYASAFR
VVFQQLAANNQIDLIPFLLENVGGISHLNQADGIHPNPQGHKIVAENVWRVIQGLL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttaatagtactatttatatgagtggaaaatatttatttgtcggcatgctg
ttgttggccttactgggcagttgcggaaataatgcagataaaacaaacgataccggcaaa
caaaaaagggaacaattgcctgcacaagccggtaaagaaaaggccaaaacgatcgtcttc
tttggaaacagtttaaccgctggttatggggtagacccctcggaggccttcccggccctg
gtgcaggaaaaaatagattctctgcatttaccatataaagtagtgaacgcgggattgagt
ggtgaaacaacggccggggggaaaagcagaattgactggatcctgcgtcaaccggttgac
atttttgtgctggaactgggtggcaatgatggattgcgtggtattcctattgcagaaacc
tccaggaacctgcaggctattataagcagggtacgggagaagaatccccaggttaaaata
gttttggccggtatgcaggtaccgcccaatatggggcgtacgtatgccagtgccttccgt
gtggtatttcagcaactggcggccaataatcaaatagaccttattcccttcctgttggaa
aatgtggggggcatcagtcatttgaaccaggccgatggcattcatcccaatccccagggg
cataagatcgtagctgaaaatgtgtggagggtaatacagggattattgtaa

DBGET integrated database retrieval system