KEGG   Niastella koreensis: Niako_0359Help
Entry
Niako_0359        CDS       T01679                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nko  Niastella koreensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_0359
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Niako_0359
Enzymes [BR:nko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Niako_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432847..433632
Genome map
AA seq 261 aa AA seqDB search
MNILDKIIEHKRAEVAERKKQTSVQELEQQEGFKRSILSLGQFLLDDAKTGIIAEFKRKS
PSKGIINGEADVAAVTSAYARYGASGLSVLTDEQFFGGSTADLIKARINQVPILRKDFMI
DEYQIVEARSMGADVILLIAACLTPAEVKRLASFAASLQLEVLLELHAEEELEHICDETK
LVGINNRNLKTFEVDIERSLRMAERIPAGKIKIAESGISSVANIQLFKQNGFRGFLIGEN
FMKEAQPGEAFHTFIAQLETK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgacaaaataattgagcacaaaagagcagaggtagcggagcggaaaaaa
caaacctccgtacaggaactggaacaacaggaagggtttaaacgttctatattgtcgctc
gggcagtttttgctcgatgacgccaaaaccggcattattgccgagtttaaacggaagtcg
ccatctaaaggcattatcaatggcgaggcagatgtggcagcagttacttccgcttatgcc
cgctatggcgcttcgggtttatccgtactcaccgatgaacaattttttggcggcagtact
gccgacctgataaaagcaagaattaaccaggtgcctattctgcgtaaggatttcatgatc
gatgaataccagattgtggaagccaggtccatgggggccgatgtgatcctgttaattgca
gcctgcctgacaccggctgaagttaaacggttggcatcttttgcggcttctttacagttg
gaagtattgctggagttacatgccgaagaagagctggaacatatttgtgacgagacgaaa
ctggtaggcatcaacaaccgcaacctgaaaacttttgaggtagacattgagcggagcctg
agaatggcagaacgcattccggccggcaagatcaaaattgccgaaagcgggatcagttct
gttgctaacattcagctcttcaaacaaaatggttttcgtggattcctgattggagagaat
tttatgaaagaagcccaacccggcgaggcatttcatacattcatagcgcaactggaaact
aaataa

DBGET integrated database retrieval system