KEGG   Niastella koreensis: Niako_0359Help
Entry
Niako_0359        CDS       T01679                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nko  Niastella koreensis
Pathway
nko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01130  Biosynthesis of antibiotics
nko01230  Biosynthesis of amino acids
Module
nko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Niako_0359
Enzymes [BR:nko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Niako_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Abhydrolase_9
Motif
Other DBs
NCBI-ProteinID: AEV96757
UniProt: G8TQM3
Position
432847..433632
Genome map
AA seq 261 aa AA seqDB search
MNILDKIIEHKRAEVAERKKQTSVQELEQQEGFKRSILSLGQFLLDDAKTGIIAEFKRKS
PSKGIINGEADVAAVTSAYARYGASGLSVLTDEQFFGGSTADLIKARINQVPILRKDFMI
DEYQIVEARSMGADVILLIAACLTPAEVKRLASFAASLQLEVLLELHAEEELEHICDETK
LVGINNRNLKTFEVDIERSLRMAERIPAGKIKIAESGISSVANIQLFKQNGFRGFLIGEN
FMKEAQPGEAFHTFIAQLETK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgacaaaataattgagcacaaaagagcagaggtagcggagcggaaaaaa
caaacctccgtacaggaactggaacaacaggaagggtttaaacgttctatattgtcgctc
gggcagtttttgctcgatgacgccaaaaccggcattattgccgagtttaaacggaagtcg
ccatctaaaggcattatcaatggcgaggcagatgtggcagcagttacttccgcttatgcc
cgctatggcgcttcgggtttatccgtactcaccgatgaacaattttttggcggcagtact
gccgacctgataaaagcaagaattaaccaggtgcctattctgcgtaaggatttcatgatc
gatgaataccagattgtggaagccaggtccatgggggccgatgtgatcctgttaattgca
gcctgcctgacaccggctgaagttaaacggttggcatcttttgcggcttctttacagttg
gaagtattgctggagttacatgccgaagaagagctggaacatatttgtgacgagacgaaa
ctggtaggcatcaacaaccgcaacctgaaaacttttgaggtagacattgagcggagcctg
agaatggcagaacgcattccggccggcaagatcaaaattgccgaaagcgggatcagttct
gttgctaacattcagctcttcaaacaaaatggttttcgtggattcctgattggagagaat
tttatgaaagaagcccaacccggcgaggcatttcatacattcatagcgcaactggaaact
aaataa

DBGET integrated database retrieval system