KEGG   Niastella koreensis: Niako_0362Help
Entry
Niako_0362        CDS       T01679                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nko  Niastella koreensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_0362
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Niako_0362
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Niako_0362
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Niako_0362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
434868..436115
Genome map
AA seq 415 aa AA seqDB search
MTTTTTYQQPNVQGYYGKFGGAFIPEMLHRNVEELRSKYLDIIYDPAFQKEYKALLHDYV
GRPSPLYYAKRLSEQYGTQIYLKREDLCHTGSHKLNNALGQILLAERLGKKRIIAETGAG
QHGVATATVCALKGVECIVYMGEKDIERQAPNVARMKMLGATVIPATSGSKTLKDATNEA
IRDWINNPVDTHYIIGSVVGPHPYPDMVARFQSIISEEIRYQLKEQAGTELPSHVLACVG
GGSNAAGTFYHFLEEPTVQLVAVEAAGHGVHSGLSAATTQLGKPGVLHGSKSLVMQTEDG
QVVEPHSISAGLDYPGIGPLHANLYDSGRGVFLSATDEEALQAAFNLAQKEGIIPALESS
HALASLEFLNPLKPKKTEAPIPAKAMFTKDSTVVVCLSGRGDKDMATYMKAMESK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaacaacaacatatcaacaaccaaatgtacaggggtattatggaaagttcggt
ggcgcattcattcccgaaatgctgcaccgcaatgtggaagagctgcgttcaaaatacctc
gacattatttacgatcctgctttccagaaagaatataaggctctgttgcacgattatgta
ggccggccttcgccgctgtattatgccaaacgcctgagtgaacaatacggtacgcagatt
tacctgaaacgggaagacctgtgtcataccggttcgcataaactgaataatgccctcggc
cagatcttactggcagagcgcctgggcaaaaaacgcattatcgccgaaaccggcgccggc
caacacggtgtggctaccgccactgtatgtgcgttgaaaggagtggagtgtattgtgtat
atgggtgaaaaagacatcgagcggcaggcgcccaatgtggcccgcatgaaaatgctgggc
gctacggtgatccctgcaaccagcggcagcaaaacattgaaagatgctaccaatgaagct
atccgcgactggatcaacaatcccgtggatactcactatataattggcagtgtggttgga
ccgcacccatatcctgatatggtagcacgttttcaaagtatcatcagtgaagaaatccgt
taccagttaaaagaacaggcaggtactgaattgccttcccacgtactggcctgtgtaggc
ggcggcagtaatgcagccggtacattttatcatttcctggaagagccaaccgtacaactg
gtagctgtagaagcggccggacatggcgtacacagcggcttaagcgctgctaccacgcag
ttaggtaagccaggggtattgcatggcagcaaaagcctggtaatgcaaaccgaagatgga
caggtggtagaaccacacagcatttctgcagggcttgattacccgggcattggaccattg
catgccaacctgtatgattcaggccgcggcgtgttcttaagcgctaccgatgaagaagct
ttacaggcagcctttaacctggcgcaaaaagaaggcatcatccccgcgttggaaagttcc
cacgccctggccagcctggagtttctgaacccgctgaaacctaaaaaaacagaagcgcct
ataccggcaaaagctatgttcacaaaagattcaacggtggtggtttgtttaagtggaaga
ggtgataaagacatggctacttatatgaaagcaatggaatcgaaataa

DBGET integrated database retrieval system