KEGG   Niastella koreensis: Niako_0363Help
Entry
Niako_0363        CDS       T01679                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nko  Niastella koreensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_0363
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Niako_0363
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Niako_0363
Enzymes [BR:nko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Niako_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
436206..436976
Genome map
AA seq 256 aa AA seqDB search
MSRIQELFKQKQNNVLNVYCTAGYPKLDSTVPVMKALQDSGVDMIELGMPYSDPLADGPV
IQASSTQALANGMTIATLFEQLRGFRKEIYVPVILMGYMNPVLQYGFERFCQDAADMPID
GLILPDLPEYEFETEYGPIMQRYGLNFIFLVTPETSGERIRRLDSLSTGFLYAVSSSSTT
GKDKDMNAVNNYLQKLQDMKLKNPVLVGFGIKDKATFQQACEHANGAIIGTAFIKALEST
SDVAGVTKKFITDIKS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaattcaggagctatttaaacagaaacagaataacgtattgaacgtgtactgc
accgcaggttatccaaaactggatagcacggtaccggtaatgaaagcattgcaggatagc
ggggtagatatgattgagctgggcatgccttacagcgatccgctggccgatggcccggtg
atccaggcaagcagcacccaggcccttgccaatggtatgaccattgccactttgtttgaa
cagttaagaggttttagaaaagagatatatgtgccggttattttaatgggttacatgaac
ccggttttacaatacggttttgaacggttctgccaggatgcagcagatatgcccatcgat
ggcctcatcctgcctgatcttccggagtatgaatttgaaacggaatatggtccaattatg
cagcgctatggattgaactttattttcctggttacacccgaaacctccggggagcgcatt
cgcaggctggatagtttaagcaccggtttcctgtatgccgtgtcttcctcttctaccacg
ggtaaagacaaagacatgaacgccgtgaacaactacctgcaaaagctgcaggatatgaaa
ttgaagaatcccgtactggtaggctttggcataaaagacaaagcaacctttcaacaggcc
tgtgaacacgccaatggcgccattatcggcacggcgttcatcaaggcgctggaaagtacc
agcgatgtagcgggcgttaccaaaaagtttataactgatattaaaagctga

DBGET integrated database retrieval system