KEGG   Niastella koreensis: Niako_0380Help
Entry
Niako_0380        CDS       T01679                                 

Definition
(GenBank) Succinyl-CoA ligase (ADP-forming) subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nko  Niastella koreensis
Pathway
nko00020  Citrate cycle (TCA cycle)
nko00640  Propanoate metabolism
nko00660  C5-Branched dibasic acid metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Module
nko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Niako_0380
   00640 Propanoate metabolism
    Niako_0380
   00660 C5-Branched dibasic acid metabolism
    Niako_0380
Enzymes [BR:nko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Niako_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEV96778
UniProt: G8TQP4
Position
complement(454089..455300)
Genome map
AA seq 403 aa AA seqDB search
MNLHEYQAKELLKKYNVPVQEGIPVDRADAAEEAYKNLKVQFGNNFAVVKAQIHAGGRGK
GKVQGTEQRGVAVGKSAEEIKNIASNLLGGTLVTIQTGPAGKVVNKVLVAQDVYYPGPNP
VKEFYLSILLDRTKGQNVIMYSTEGGMDIEEVAHNTPDRIFKEWVHPGGGLQAFQARKIA
FNLGLKGEAFKNCVKFVTNLYNAYVGLDCAMLEINPLFKTADEKIIAVDCKMGLDDNSLM
RHPELEALRDISEEDPTEVEAGKYNLNFVKLDGNVGCMVNGAGLAMATMDMIKLSGGEPA
NFLDVGGTANATTVEAGFRIILKDPKVKAILINIFGGIVRCDRVAQGVIDAYKSIGNITV
PIIVRLQGTNAEEAKKLIEESGLKVQSAILLSEAAALVGKAVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgaataccaggcaaaggaattactgaaaaaatacaatgtaccggtgcag
gaaggaataccggttgacagagccgacgcggccgaagaagcatataagaatttaaaggtt
caatttggcaacaacttcgcggttgttaaagcacagatccatgcaggtggtcgcggaaaa
ggcaaagttcaaggcaccgaacaacgcggtgtggcagtaggtaaaagtgccgaagaaatc
aaaaatatcgcctccaatttattgggcggtaccctggttaccattcaaacaggccctgcc
ggtaaagtggtgaacaaagtactggtagcgcaggacgtatattatcctggtcctaacccg
gtaaaagagttctacttatcaattctgctcgatcgtacaaaaggccagaatgtgatcatg
tacagcaccgagggtggtatggacattgaagaagtagcccacaacacccccgacaggatc
ttcaaagaatgggtacacccaggcggaggtttacaggctttccaggcgcgtaaaattgcg
ttcaacctgggactgaaaggcgaagccttcaaaaactgcgtaaaattcgttaccaattta
tacaatgcatacgttggtttagactgcgctatgctggaaatcaacccattgttcaaaaca
gccgacgaaaagatcattgctgttgactgtaaaatgggtctggatgacaactccctgatg
cgtcaccccgagctggaagccctgcgcgatatcagcgaagaagatcctaccgaagtggaa
gctggtaaatacaacctgaacttcgtaaaactcgatgggaacgtaggttgtatggtaaac
ggcgccggtttggccatggctaccatggatatgattaaactgagcggcggtgagccagcc
aacttcctggacgtaggtggtactgccaatgctactactgtagaagctggtttccgcatc
atcctgaaagatccaaaagtaaaagcgatcctcatcaacatctttggtggtatcgttcgt
tgcgaccgggttgcccagggagtaattgatgcctataaatcaatcggcaacatcaccgta
cctatcatcgttcgtttacagggtaccaatgccgaagaagctaaaaagctgatcgaagaa
agcggtctgaaagtacaatcagccattctgttgagcgaagctgctgccctggtgggtaaa
gcggttgcttag

DBGET integrated database retrieval system