KEGG   Niastella koreensis: Niako_0442Help
Entry
Niako_0442        CDS       T01679                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nko  Niastella koreensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nko00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
535911..536756
Genome map
AA seq 281 aa AA seqDB search
MSIKLGKNTYGKNAVNLSKIIRHPDYHEFRQISVNVILEGDFETAHTIGDNSKLLPTDTQ
KNTVYALAKEHFVSSIEAFGLYLANYFASNNPQVSQVRIELTEHSWARMRFNGTVHPHAY
CSGGNEKHTATVVQNKNGIEVTAGITGLLILKTTDSGFENYIKDQYTTLKETSDRIFATE
CEVSWVYNSSNILFVELFNGIRTTLLQTFADHQSLSVQHTLYAMGEAVLEKFAAVNEITL
KMPNKHHILYNLEQFGMDNKNEVFIATDEPYGYITGTVVRE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaactgggtaagaacacctatggtaaaaatgctgtaaacctatcaaagatc
attcgccatcccgattaccatgaattcaggcagatctcagtgaatgtgatactggaaggt
gattttgaaactgcccacaccattggcgataattcaaaactattgcctactgatacccaa
aaaaatacggtgtatgcgttggcgaaggaacactttgtttcttccatcgaggcttttgga
ttgtacctggctaattattttgccagcaataatccccaggtttcccaggtacgaattgaa
ttgacggagcacagctgggcgaggatgcgttttaatggaaccgtacatccgcatgcttac
tgcagcggaggaaacgagaaacatactgctaccgttgtgcaaaataaaaatggcattgag
gtaacagccggcatcaccggcctgctgatcttaaaaacaaccgattcaggttttgagaat
tatattaaggatcaatacaccacgctgaaggaaaccagtgaccgcatctttgccacggaa
tgcgaagtaagctgggtgtataattcttccaatatcctgtttgtggaattgttcaacggg
atacgaactacgttattacaaacctttgccgatcaccagagcctttctgtacagcacact
ttgtatgccatgggcgaggcggtgttggaaaagtttgcagcggttaatgagattaccctg
aagatgccaaacaagcaccacatcttatacaatcttgaacaatttggaatggataataag
aacgaagtgtttattgctaccgatgaaccgtatgggtatataacaggtacggtggtgcgg
gaatag

DBGET integrated database retrieval system