KEGG   Niastella koreensis: Niako_0578Help
Entry
Niako_0578        CDS       T01679                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nko  Niastella koreensis
Pathway
nko00900  Terpenoid backbone biosynthesis
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01130  Biosynthesis of antibiotics
Module
nko_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Niako_0578
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Niako_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: AEV96973
UniProt: G8T920
Position
700139..701308
Genome map
AA seq 389 aa AA seqDB search
MSNSFPHRRIAIFGSTGSVGSQALEVIASNPDKFSAEVLTAFSNEELLIKQALQFNPNIV
VIGDEAKYKIVKEALSHTDVKVFAGEKALEEVASMDVYDMMLAAIVGFAGLRPTLCALDA
GKAVALANKETLVVAGDIVMQKAIEKRVPVIPVDSEHSAIFQCLVGETRNKIEKVILTAS
GGPFLGKKPNYLVNVKRDHALQHPNWQMGAKITIDSATLMNKGLEMIEARWLFDLQADQV
QVLVHPQSIIHSMVQFEDGSIKAQMGLPDMKLPIQYALAFPHRIPNQFPRYNFRTPAQLT
FEEPDTKTFRNLQLATDALFRGGNQPCVLNAANEIAVFAFLRNRIGFLDMTDLIERTLQH
VPVIEKPTLEEYFDSDGEARNFAASLIKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacagttttccacacagacgcatagcaatattcggctcaacaggctcagtgggt
agtcaggcgttggaagtgattgcttccaatcccgacaaattctccgccgaggtattgact
gcttttagtaacgaggagttgttgattaaacaggccttacaattcaatcccaatattgta
gtaataggtgacgaggctaaatataaaatagtaaaggaagccctttcacataccgatgta
aaagtatttgccggtgaaaaagcactggaagaggtagccagcatggatgtgtatgatatg
atgctggcagccattgttggctttgccggcttacgccctacgttatgcgccctggatgca
ggtaaagccgtagcgctggccaataaagaaacgctggtagtggccggtgatattgtaatg
cagaaggccatcgaaaaaagagtgcctgttattccggtagattccgaacactcggccata
tttcagtgtttggtaggtgaaacccgcaacaagatcgagaaagtgatcttaacagcgagc
ggcggtccctttcttggtaaaaagcccaattacctggtgaatgtaaagcgcgatcatgcg
ctgcagcatcctaactggcaaatgggagcaaagatcaccatcgactcggccactttaatg
aacaaagggcttgaaatgatagaagcccgctggttgtttgacctgcaggccgaccaggta
caggtacttgttcacccccaaagtattattcatagcatggtgcagtttgaagatggaagt
attaaagcgcagatggggctgcccgatatgaaactgcccattcagtatgccctggctttc
ccgcatcgtatacccaaccagttcccgcggtataatttcagaacccccgcccagcttaca
tttgaggaacccgataccaaaacattccgcaacctgcaactggccaccgacgccctcttc
aggggtggaaaccagccctgtgtgctgaatgccgccaatgaaattgccgtattcgcattt
ttacgcaatcgtattggctttttggatatgaccgatctcattgaacggaccctgcaacac
gtgccggttatagaaaaacccacgctggaagaatattttgacagcgatggggaggcccgt
aattttgccgcctcccttattaagctctaa

DBGET integrated database retrieval system