KEGG   Niastella koreensis: Niako_0670Help
Entry
Niako_0670        CDS       T01679                                 

Definition
glucan endo-1,6-beta-glucosidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
nko  Niastella koreensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Niako_0670
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Niako_0670
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Niako_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(794037..795923)
Genome map
AA seq 628 aa AA seqDB search
MFPQSKRSWPLQALTLLCAALIPFSCTRDVSPSPTQGPTVARAANETVNVWMTTGDKSKL
LQQQAAINFAADAGTNPVTVTVDETVTYQSIDGFGFTLTGGSASLINGLGANQTAFLNEI
FSPSQVGSSFLRLSIGASDLSPADFTYDDMPSGQTDLNLNNFNINAEMTDLVPVLKKIVA
INPSIKILATPWTAPVWMKVSTTGNGGFTGGSLNTSSAYYDAYARYFVKYIQAMQAQGIN
IYAVCPQNEPMNPYNNPSMTMSAGEQANFIKNYLGPQFSNNGISTRIICYDHNCDHPEYP
TTVLGDAAANQYIDGSAFHLYSGQIDALTTVHNAFPAKNVYFTEQYIGGPGNFGGDLSWH
VNNVVIGSTRNWSKAALEWNLAADPNYFPHTSGGCSNCMGAVTISGNSYSRNTAYYIIAH
ASQFVKQGAVRISSNTPGSIQNVAFKNPDGSKVLLALNTSGSSVSFKVKWGNESFTYTLA
AGAVATFKWTGTQSSGGGGGSGAPIGQTITLKGFNGQYVSGENGTQAMNCNRPTAQAWEQ
FLVVDAGGGKIALQSMGKYVSSENGVNPITCNRATVGAWEQFTWIVNADGTIALQGNNGR
YISSENGAQAMTCNRTAISGWEAFGVNQ
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgttccctcaaagcaaacgatcatggccgttgcaggcccttaccctgctatgcgcggca
ctgatccctttttcctgtacacgagatgtttcgccctcccccactcagggacccactgtg
gccagggcagccaacgaaacagtgaatgtgtggatgaccaccggcgataaatccaaactg
ttacaacaacaggcagccattaattttgcggccgatgcgggcaccaacccggttactgta
acagttgatgaaacggtgacttaccaatccatagatggttttgggtttaccctcactggc
ggaagcgcttcgctcattaacggattgggcgctaaccaaactgcttttctgaatgagatc
ttcagtccctcacaggtaggctcaagctttttgcggttaagcatcggtgcttctgacctg
agcccggccgattttacctatgatgatatgccttccggccaaacagacttaaatctcaac
aacttcaacattaacgccgaaatgaccgacctggtgccggtgctgaagaagatcgtggct
atcaatccttccatcaaaatcctggccactccctggacggccccggtatggatgaaggtg
agcacaacaggtaacggcggattcaccggcggcagtctgaacaccagcagcgcctattac
gatgcctatgcacgttactttgtaaaatatatccaggccatgcaggcacagggcatcaac
atttacgcggtgtgtccacagaacgaaccaatgaacccgtacaacaatccatcgatgacc
atgtcggccggagaacaggctaatttcatcaagaattacctgggcccccagttcagtaac
aatggcatcagtacgcgaatcatctgttatgatcataattgcgaccacccggagtatccc
accaccgtactgggcgatgccgcggccaaccagtatatcgatggttctgcttttcacctg
tacagcggccagatcgatgcgcttactaccgtgcacaatgcgttccctgccaagaacgtt
tattttaccgagcaatacatcggaggccccggcaattttggcggcgacctctcctggcac
gtgaacaatgtggtgatcggttcaaccaggaactggagcaaggcagcccttgaatggaac
ctggctgctgaccccaattattttccgcataccagtggcggttgttcaaactgtatgggc
gctgttaccatctccggtaattcttattcacgcaacaccgcctattatattattgcgcat
gcctcacaatttgtaaaacagggcgcggttcgcatttcatccaacacaccgggaagcatc
cagaacgtagccttcaaaaatcctgatggctccaaggtattgcttgcactcaatacatct
gggtcaagcgtatcgttcaaagttaaatggggtaatgaatcctttacgtataccctcgcg
gcaggcgccgttgctacgtttaaatggacgggcacgcaatcttccggcggtggcggcggc
agcggtgcacctattggccaaaccattacgttgaaaggttttaacggtcagtatgtaagt
ggtgaaaatggaacgcaggctatgaactgcaaccggccaactgctcaggcctgggaacag
ttcctggtagtggatgccggcggcggcaagatagcgctgcaaagcatgggcaaatacgtt
tccagtgaaaacggcgtaaaccctattacctgtaacagggccacggttggcgcctgggag
cagtttacctggatcgtgaatgccgatggcaccattgccctgcagggtaataatggccgc
tatatcagcagcgagaacggcgcccaggctatgacctgtaatcgtacagccatcagtggt
tgggaagcatttggagtaaatcaataa

DBGET integrated database retrieval system