KEGG   Niastella koreensis: Niako_0710Help
Entry
Niako_0710        CDS       T01679                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nko00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nko00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845188..846327
Genome map
AA seq 379 aa AA seqDB search
MNKLICHVVLLALLTGVASCGGENKQPSTEKSQEMIKAGVTSKDWGETDGKKVQLFTLTN
KNGVTVTITNYGGVVTSWVTPDKNGNKSSIVVGMESLAEYLKKPPYFGALIGRYGNRIGD
AKFKLDGKTYTLAANNGKNNLHGGNKGFDKQVWDATPAADSTPALTLSYLSKDGEEGFPG
NLKVTVVYTLTDDGALNIDYSAETDKATPVNLTNHSYFNLTGSTENTILNHSLQIDADKY
TPVDTTLIPTGEIKPVKGTPFDFTKAETIGARIDQVPGGYDHNFVLNRKDSTLQLVATLS
DTTSGRKLEVYTTEPGLQFYSGNFLDGTFTSGGHPVKLRTALCLETQHFPDSPNKPNFPT
TILKPGQKYHTVTKYKVSL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgatttgccatgtagtcttgcttgcgctgcttaccggcgtagcatcctgc
ggcggcgaaaacaaacaaccttcaacagaaaaatctcaggaaatgattaaagcaggcgtt
acctcaaaagattggggtgaaacagatggaaaaaaagtacagttgtttacccttaccaat
aaaaacggtgttaccgtaaccatcaccaactatggcggcgtggtaacatcatgggtcact
ccggataaaaacggcaacaaatcaagcatcgtagtgggaatggaaagcctggcggagtac
ctgaaaaagccaccttactttggtgcgctcattggccgttatggcaaccgcattggcgat
gccaaattcaaactcgatggtaaaacctataccttagccgccaataacggaaaaaataac
ctgcatggcggtaacaaaggtttcgataaacaagtgtgggatgcaacccctgctgccgac
agcacgccggcgcttaccttaagctacctgagcaaagatggtgaagaggggttccccggc
aacctgaaagtaacggtggtgtataccttaactgacgatggcgccctgaatatcgactac
tcagctgaaaccgataaagccacaccggttaacttaaccaaccacagttatttcaacctc
actggcagcacggagaacactatcctgaatcacagcctgcagatcgatgctgataaatat
accccggttgataccacgttgatccctaccggcgagatcaaaccggtaaaaggaacgcca
tttgattttacaaaagctgaaaccattggcgcccgcatcgaccaggtacccggcggttat
gaccacaactttgtgttgaaccgtaaagacagcaccctgcaactggtagctactttatct
gacactaccagcggccgtaaactggaagtatataccactgagcctggtctgcagttttac
agtggtaacttcctcgatggtacgtttacaagcggcggtcatcccgtcaaattgcgcacc
gcactttgtttggaaacccagcatttccctgattctcccaacaaacccaacttcccaact
accatcctgaaaccaggacagaaataccacaccgtaacgaagtataaagtttcgttgtag

DBGET integrated database retrieval system