KEGG   Niastella koreensis: Niako_0710Help
Entry
Niako_0710        CDS       T01679                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_0710
   00052 Galactose metabolism
    Niako_0710
Enzymes [BR:nko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Niako_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845188..846327
Genome map
AA seq 379 aa AA seqDB search
MNKLICHVVLLALLTGVASCGGENKQPSTEKSQEMIKAGVTSKDWGETDGKKVQLFTLTN
KNGVTVTITNYGGVVTSWVTPDKNGNKSSIVVGMESLAEYLKKPPYFGALIGRYGNRIGD
AKFKLDGKTYTLAANNGKNNLHGGNKGFDKQVWDATPAADSTPALTLSYLSKDGEEGFPG
NLKVTVVYTLTDDGALNIDYSAETDKATPVNLTNHSYFNLTGSTENTILNHSLQIDADKY
TPVDTTLIPTGEIKPVKGTPFDFTKAETIGARIDQVPGGYDHNFVLNRKDSTLQLVATLS
DTTSGRKLEVYTTEPGLQFYSGNFLDGTFTSGGHPVKLRTALCLETQHFPDSPNKPNFPT
TILKPGQKYHTVTKYKVSL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgatttgccatgtagtcttgcttgcgctgcttaccggcgtagcatcctgc
ggcggcgaaaacaaacaaccttcaacagaaaaatctcaggaaatgattaaagcaggcgtt
acctcaaaagattggggtgaaacagatggaaaaaaagtacagttgtttacccttaccaat
aaaaacggtgttaccgtaaccatcaccaactatggcggcgtggtaacatcatgggtcact
ccggataaaaacggcaacaaatcaagcatcgtagtgggaatggaaagcctggcggagtac
ctgaaaaagccaccttactttggtgcgctcattggccgttatggcaaccgcattggcgat
gccaaattcaaactcgatggtaaaacctataccttagccgccaataacggaaaaaataac
ctgcatggcggtaacaaaggtttcgataaacaagtgtgggatgcaacccctgctgccgac
agcacgccggcgcttaccttaagctacctgagcaaagatggtgaagaggggttccccggc
aacctgaaagtaacggtggtgtataccttaactgacgatggcgccctgaatatcgactac
tcagctgaaaccgataaagccacaccggttaacttaaccaaccacagttatttcaacctc
actggcagcacggagaacactatcctgaatcacagcctgcagatcgatgctgataaatat
accccggttgataccacgttgatccctaccggcgagatcaaaccggtaaaaggaacgcca
tttgattttacaaaagctgaaaccattggcgcccgcatcgaccaggtacccggcggttat
gaccacaactttgtgttgaaccgtaaagacagcaccctgcaactggtagctactttatct
gacactaccagcggccgtaaactggaagtatataccactgagcctggtctgcagttttac
agtggtaacttcctcgatggtacgtttacaagcggcggtcatcccgtcaaattgcgcacc
gcactttgtttggaaacccagcatttccctgattctcccaacaaacccaacttcccaact
accatcctgaaaccaggacagaaataccacaccgtaacgaagtataaagtttcgttgtag

DBGET integrated database retrieval system