KEGG   Niastella koreensis: Niako_0720Help
Entry
Niako_0720        CDS       T01679                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nko  Niastella koreensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nko00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858224..859708
Genome map
AA seq 494 aa AA seqDB search
MPQYILSFDQGTTSSRAIIFDQAGSIISIAQKEFTQLYPQPGWVEHDAAEIWGTQLAVAV
EAVSKAGLKATDIAAIGITNQRETTVVWDRETGTPVHNAIVWQDRRTAAFCDQLKVQSGK
LIQEKTGLIVDAYFSATKIRWILDNVAGARKKAEEGKLAFGTIDTWLVWKLTGGKVHATD
ISNASRTMLFNIHTCTWDEELLKIMDVPASMLPTVHSSSEVFGQTDAQILAAQIPIAGIA
GDQQAALFGQMCTEPGMVKNTYGTGCFMLMNIGDKPILSKNNLVTTIAWKIDGKVQYALE
GSIFIGGAVVQWLRDGLGIIKNSSDVEALARSVDDNGGVYLVPAFAGLGAPYWDQHARGT
MVGITRGTTAAHIARASIESIALQTMDVLTAMQADAGKPIKELRVDGGATANDLLLQIQA
NVLQATVIRPEITETTAIGAAYLAGLAVGFWKNIDEIKKQWKLNKSFSPDGTDARQLTKG
WLKAIKAAKAFSEE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgccacaatacatcctaagtttcgaccagggtactaccagttcaagggccattatcttc
gatcaggccggttccattatatcgatagcgcagaaggaatttacgcagttgtatccgcaa
ccgggttgggtagaacatgatgcggctgagatctggggcacgcaactggccgtagccgtt
gaagcggtgagcaaagccgggttgaaggcaaccgatatcgctgccatcggcattaccaac
cagcgcgaaacaaccgtggtatgggatagagaaaccggcacgcccgtgcacaatgccatt
gtttggcaggacagacgcactgctgctttttgtgaccagttgaaagtacagtctggcaaa
ttgatccaggagaaaaccgggttgatcgtggatgcttatttttctgccaccaagatccgc
tggatcctggataatgtagcaggcgcgcgcaaaaaagcggaggaaggaaaactggccttt
ggcaccatcgatacctggctggtatggaaactcaccggcggtaaagtacatgctaccgat
atttccaatgcatcgcgcaccatgctgtttaatattcatacctgtacctgggatgaggag
ctgttgaaaataatggatgtgcccgcttctatgttgccaaccgttcattcctcgagcgaa
gtgtttggacaaacggatgcacagatcctggctgcgcagatccctattgcgggtattgcc
ggtgatcagcaggcggcgttgttcggacaaatgtgtaccgaacccggcatggtaaaaaac
acctatggcaccggttgttttatgctgatgaacattggcgacaaacctattttatcaaaa
aataacctcgtaaccactattgcctggaagatcgatggcaaagtgcagtatgccctggaa
ggcagcatcttcattggtggcgccgtagtgcaatggttacgggatggattgggtattatt
aaaaattcttccgacgtagaagcactggcccgcagtgtggacgataacggcggcgtgtac
ctggttccggcatttgccggtttgggggcgccttattgggaccagcacgcccgcggcacc
atggtgggcattacccgcggcaccacagctgcacacattgcgcgtgcctccatcgaaagc
attgccttacaaaccatggatgtgctcactgccatgcaggccgatgccggcaaaccaatt
aaagaacttcgggtagacggtggcgctacggccaatgacctgctgctgcaaattcaggcc
aatgtattgcaggcaacggtgatccgtcctgagatcaccgaaaccacggccattggcgca
gcctatctcgctggtttggccgtagggttctggaagaacatagatgaaattaaaaagcaa
tggaaactcaataaaagcttttcacccgacggtaccgatgccagacagctaacgaaaggc
tggttgaaagcgattaaagctgccaaagcattttcggaagaataa

DBGET integrated database retrieval system