KEGG   Niastella koreensis: Niako_0966Help
Entry
Niako_0966        CDS       T01679                                 

Definition
D-xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
nko  Niastella koreensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Niako_0966
   00051 Fructose and mannose metabolism
    Niako_0966
Enzymes [BR:nko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Niako_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1179086..1180414
Genome map
AA seq 442 aa AA seqDB search
MKIITGEKEFFKGIGQIKYEGVESDNPLAFKWYDENRVVAGKTMKEHLRFAVCYWHTFCN
TGADPFGPGTKHFAWDANTDAVARAKDKMDAAFEFITKLGVPYYCFHDIDLVDEGANIKE
YESRLQTIVDYAKQKQAASGVKLLWGTANVFSNPRYMNGASTNPDFAAVAYAGTQVKNAL
DATIALGGENYVFWGGREGYMSLLNTNMKRELDHLAQFLTMARDYARKQGFKGVFFIEPK
PCEPTKHQYDYDSATVIGFLRHYGLDKDFKLNIEVNHATLAGHTFQHELQVAADAGMLGS
IDANRGDDQNGWDTDQFPVDLNELVESMLIILEAKGFAGGGINFDAKTRRNSTDLEDIFM
AHIGGMDTFARALVIADKVMQKSPYLKFRKDRYASFDSGKGKEFETGALKLEDLREFALS
NGEPKQTSGKQEWLENIINQYI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattacaggcgaaaaagaattctttaaaggcattggccaaatcaaatatgaa
ggcgtggagagcgataacccactggcctttaaatggtatgatgaaaacagggtagtggct
ggtaaaaccatgaaagagcatttacgttttgcagtgtgctactggcatacgttctgtaac
acgggagccgatccgtttggtccaggtacaaaacattttgcgtgggatgcaaataccgat
gccgtagcacgtgctaaagataaaatggatgctgcgtttgaattcatcaccaaactgggt
gttccttattattgttttcacgatatcgacctggttgatgaaggcgccaacatcaaggaa
tatgaaagccgtttgcaaactattgtagattacgccaaacaaaaacaggctgccagcggt
gtgaaattattatggggaactgccaatgtgttcagtaatccccgttacatgaacggtgct
tctaccaatcctgattttgctgcagtagcttatgcgggtacgcaggtaaaaaatgcgctg
gatgctaccatcgccctgggtggtgagaattatgtgttctggggtggccgcgaaggttat
atgagcctgctgaacacgaacatgaaacgtgagctcgatcacctggcgcaattcctcact
atggcgcgtgattatgcccgcaaacagggtttcaaaggtgtgttctttattgaacccaaa
ccttgcgaacctaccaagcaccaatacgattatgacagcgcaaccgtgatcggtttcctg
cgtcattacgggcttgataaagactttaaactgaatattgaggtaaaccatgccacgctg
gccgggcataccttccagcacgaattacaggtagctgccgatgcaggtatgctgggcagc
atcgatgccaaccgcggcgatgaccagaacggctgggataccgatcagttcccggttgac
ctgaacgagctggtagaaagcatgctcatcatcctggaagcaaaaggctttgccggtggt
ggaattaacttcgatgccaagacccgccgtaattcaaccgacctggaagatatcttcatg
gcgcacattggtggtatggacacttttgcccgcgccctggtaattgcggataaagtaatg
cagaaatcgccttacctgaagttccgcaaagaccgctatgcttcttttgatagcggtaaa
ggaaaagagtttgagaccggcgctttaaagctggaagacctgcgggagtttgccctgtcg
aatggcgaacccaaacagaccagcggtaagcaggagtggctggagaatatcatcaatcag
tacatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system