KEGG   Niastella koreensis: Niako_1167Help
Entry
Niako_1167        CDS       T01679                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nko  Niastella koreensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Niako_1167
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Niako_1167
Enzymes [BR:nko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Niako_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422398..1423333
Genome map
AA seq 311 aa AA seqDB search
MQLSVKHLLGIRDLTRQDIQIILDTATQFKEVLQRPIKKVPSLRDVTIVNLFFENSTRTR
ISFELAEKRLSADTINFTASASSVSKGETLLDTVNNILSMKVDMVVMRHSASGAPHFLAK
HIPAAIVNAGDGINEHPTQGLLDAFSMREKLGRLEGLKVAIIGDIMHSRVAMSNIYLLKK
MGAEVMVAGPPTLIPKYIREAFDIRVEYNLRKALEWCDVANVLRIQLERQNQVLFSSLRE
YSLAYGINKRLLDSLDKKIVIMHPGPINRGVELDSDAADGNQSIILNQVENGVAVRMAAL
YLLSGGREMTN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcaactttcagttaaacatctgctcggtatacgggatctcacccgtcaggatatacag
attattttagatactgccacccaattcaaggaagttctacaacggcctatcaagaaagtt
ccttctttgcgggatgttactatcgttaacctgtttttcgaaaattcaacccgtaccagg
atctcttttgagctggctgaaaaacgcctgagcgccgacaccattaactttacggccagc
gcttcttccgtttcaaaaggggagaccctgctggataccgtgaataatattttgtcgatg
aaagtagacatggtggtaatgcggcatagtgccagcggcgccccccactttctggcaaaa
catattccggcggcaatcgtaaatgcaggagatggcattaacgaacaccccacccagggc
ttgctcgatgctttttccatgcgcgaaaaactgggtcgcctcgaagggttgaaagtggcc
atcatcggcgacatcatgcactcgcgggtagcaatgagtaatatttacctgttgaagaaa
atgggcgccgaagttatggtagcaggtccgcccaccctgattccaaagtacatccgggaa
gcattcgatatccgggtggagtacaacctgcgaaaagcgctggagtggtgcgacgtggca
aacgtgctgcggatccagctcgaacgccagaaccaggtacttttctcttcgctgcgggaa
tacagcctggcatatgggatcaacaaacgcttactcgatagcctcgataaaaaaatcgtg
atcatgcaccccggccccatcaacagaggggtggaactggacagcgatgccgccgacggt
aaccagagtatcattttgaaccaggttgaaaatggggtagcggtgcggatggccgctttg
tacctgttatccggtggccgggaaatgacaaattag

DBGET integrated database retrieval system