KEGG   Niastella koreensis: Niako_1475Help
Entry
Niako_1475        CDS       T01679                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
nko  Niastella koreensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Niako_1475
  Lipid metabolism
   00561 Glycerolipid metabolism
    Niako_1475
   00600 Sphingolipid metabolism
    Niako_1475
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Niako_1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826498..1828693
Genome map
AA seq 731 aa AA seqDB search
MQKNTRGLIGIAAITLLSFLQQDVFSQKVTIPIETQHNALVLQTNATNNLGIIYLGPKLS
DKIEYEAIPAAYKQTTDYTGVANAAYATSGSRNLFEPAITVTHADGNNSLDLQYVSYETK
KLDDNTSLLTIVLKDPVYELEVKLFYKTWYNEDVTEQWTEIKNNEKGNVVLQKYASAGLY
LKADNFYLRQYHGDWAKEMQPEESRITHGIKTLDSKLGTRADLFQPPVFMVSLNKPATED
EGSVLYGALEWSGNFKIDLELDNQDNLRIIAGVNNHASPYTLKPGEVLTTPAFLSVLSHK
GKGEASRQLQAWARNYKLLDGKGTRLTLLNNWESTYFDFNETKLKALLKDTKELGVDLFL
LDDGWFANKYPRNDDHAGLGDWQENKSKLPNGIATLVSEGQHNGVRFGIWVEPEMVNPKS
ELYEKHPDWVVRQPKRPEYYFRNQLVLDLTNPQVQDFVFNVIDNLFTKNPNLAYIKWDCN
AVVYNAYSAHLTNQSHFYLQYVQGLYSVLQRIRKKYPTVPMMLCSGGGGRVDYGALQYFT
EFWPSDNTDPLERIFMQWEYSYFYPAISSSNHVTDWGKQPLKYRTDVAMMGKLGFDIVVS
KLNASDLEFCRYAIKNYDAFKYVILQGDQYRLQDPRDNAVAAMMYLNPDKRSGIVFNYLV
NNRYDEGSARPIKMKGLDPRQRYRLTELNLYPGTTSTIADKSYTGEFLMTVGYNPDVKAS
RTSVVLLVKAE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaatacgcgcggtttgatagggattgcagccattaccttattatccttttta
cagcaagatgtattttctcaaaaggtaaccatacctatagaaacacagcataacgcgttg
gtattgcaaacaaatgccactaataatctcggtattatttacctggggccaaaactgagc
gataaaattgaatacgaagccatcccggctgcgtacaaacaaactaccgattacaccggg
gttgccaatgcagcctatgccacatcgggttcgcgcaatttgtttgagcctgccattacg
gtaacccatgcagatggcaataactcgctcgatctgcaatatgtatcgtatgaaacaaaa
aagctggacgataatacttctctgcttaccatagtattgaaagatcctgtgtatgagttg
gaagtgaaattgttttataaaacctggtataatgaagatgtgaccgaacagtggaccgaa
ataaaaaacaacgagaaaggcaatgtggtgttgcagaaatatgcttcggcaggtttgtac
ctgaaggcagataacttttacctgcgtcaataccatggcgactgggccaaggaaatgcaa
ccggaagaaagccggataacgcatggcataaaaaccctcgattcaaaactgggtacccgc
gccgatctgtttcagccaccggtttttatggtgtcgctgaacaaaccggctaccgaagat
gaaggttcggtattatatggggcgctggaatggagcggtaatttcaagatagacctggag
ctcgataaccaggataacctgcgcattattgccggggtaaacaaccatgcatcaccctat
actttaaaacccggcgaagtgctgaccacacctgcgtttttatcggttttgtcgcacaag
ggcaaaggcgaagcaagccgccagttgcaagcctgggcgcgtaactacaaactgctggat
ggcaaaggcacgcggcttacattgttgaacaactgggaaagcacctattttgattttaac
gaaacgaaattaaaggcgctgttaaaagataccaaagaactgggggttgacctgttcctg
ctcgatgatggctggttcgccaataaatatccgcgtaacgatgatcatgcaggtttgggc
gactggcaggaaaataaatcgaaacttcccaatggcattgctacgctggtttccgaaggc
cagcataatggggtgcggtttggtatttgggtggagcccgaaatggtgaaccctaaaagt
gaattgtatgagaaacatcctgactgggtagtaaggcaacccaaacggcctgaatattat
ttcaggaaccagttggtgctcgatcttaccaatccgcaggtgcaggattttgtatttaat
gtgatcgacaacctgtttactaaaaacccgaacctggcgtacataaaatgggattgtaat
gcggttgtatacaatgcctactcggcccatttaaccaatcaatcccatttctatttacaa
tatgtacagggtttatacagtgtattgcaaaggatcaggaagaaatatcccactgtgcct
atgatgttgtgctcgggtggcggcggacgtgttgattatggcgcgctgcaatactttacc
gagttctggccaagtgacaataccgatccgctggaacgcatttttatgcaatgggagtat
tcttatttttatcccgccatcagttcatccaatcacgtgaccgactggggcaagcaaccc
ctcaagtaccgtacagatgttgccatgatgggtaaactgggttttgatattgtggtgagc
aaactgaatgcaagcgatctggaattctgccggtatgcgataaaaaattatgatgcattc
aagtatgtgatcctgcagggcgatcaataccggttacaggacccccgggataatgccgta
gccgccatgatgtatctgaatcccgataaaagatcgggtattgtattcaattacctggta
aataaccgctacgatgaaggcagtgcacggcctattaagatgaaagggctcgatccccgg
caacgataccggttaacagagctgaacctgtatcccggtaccacttcaaccattgccgat
aaaagctataccggcgaattcctgatgacggttgggtacaatcctgatgtaaaagccagc
cggacaagtgtagttttgctggttaaggcggagtga

DBGET integrated database retrieval system