KEGG   Niastella koreensis: Niako_1511Help
Entry
Niako_1511        CDS       T01679                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nko  Niastella koreensis
Brite
Enzymes [BR:nko01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Niako_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1872483..1873139
Genome map
AA seq 218 aa AA seqDB search
MRTFEDTYRHKGLRKQLVDQLKQKGITDERVLTAILQIPRHYFLDSALDRVAYEDRAFPI
AEGQTISQPYTVAYQTQLLEVKPYEKVLEIGTGSGYQAIVLGEMQAQVYTIERQKKLYEE
HRGFVLRSKYPNIKYFYGDGYEGLPTYAPFDKVIVTAAAPYIPPKLIDQLKPGGKMVIPV
GEGNIQRMLRLTKQRDGSVTEELFDNFSFVPMLEGKNS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagaacgtttgaagatacttaccggcataaaggattgcgtaaacaactcgttgatcaa
ttaaaacagaaaggcattaccgacgaacgggtgctgacagccatattacagattccccgg
cattatttcctcgattcagctttagacagggtcgcttatgaagaccgggcttttcctatt
gcagaaggtcaaaccatttcacaaccatatacggtggcctatcaaacccagttactggaa
gtaaagccgtacgaaaaagtgcttgaaattggtacgggtagtggataccaggcaattgta
ctgggcgaaatgcaggcccaggtgtatactattgagcggcagaaaaagttgtatgaagaa
caccgcggttttgtgttgagaagcaaatatcccaacattaaatacttttatggcgatggg
tatgaaggcctgcccacgtacgcaccttttgacaaggtgattgttacggcggccgccccc
tacattccacctaaactgatagaccagttaaaaccaggtggcaaaatggtaataccggta
ggcgagggcaacattcaacggatgttacgccttaccaaacaacgcgatggtagtgtaaca
gaagaattattcgacaatttttcgtttgtgccaatgcttgaaggaaagaacagttaa

DBGET integrated database retrieval system