KEGG   Niastella koreensis: Niako_1518Help
Entry
Niako_1518        CDS       T01679                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nko  Niastella koreensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Niako_1518
Enzymes [BR:nko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Niako_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1881228..1882274)
Genome map
AA seq 348 aa AA seqDB search
MTDLSHFDPNAASNPNNNIFGLPFTEEDARLVILPVPWEVTVSYNAGTARAADHIFKASM
HVDLFDPETKDSWKQGFYMRPPDKKVLLKSDYLRKEAELYIDYICHGEVLEKNLFMCKSL
RDINEGGGYLNKWVYEQCKQLLNRGKLVSILGGDHSVVLGFFKAMAEQHGEFGVLQIDAH
CDLRASYELFTYSHASVMYNALKEIPTLTHLVQIGARDYCQEEWEYIQNNKDRVIPYFDK
DIKERQFEGETWKQITDEIVGKLPEKVLVSFDIDGLDPKLCPNTGTPVQGGFETEQIFYL
LKKIVQSGRKFIGFDLVEIGVGDNNEWDANVGAHILWRLANLLVASNQ
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctatcgcactttgatcccaacgcggcaagcaatcccaacaataatattttt
ggtttgccctttactgaagaggatgcccgtttggttatactaccagttccctgggaagtt
accgtaagctataatgccggtactgcccgggccgccgaccatatttttaaagcaagtatg
cacgttgacctttttgaccctgaaaccaaagattcgtggaagcagggtttttatatgcgt
ccgcccgataaaaaggtgctgctgaaaagtgactacctccgcaaggaagccgagttgtac
atcgactatatttgtcatggcgaagtactggagaagaacctcttcatgtgcaaatcgctg
cgcgatatcaacgaaggcggcgggtatttgaacaaatgggtgtacgagcaatgcaaacaa
ctgctcaaccgcggtaagctggtctccatcctgggtggcgatcacagtgtagtgctgggc
tttttcaaggcaatggccgaacagcatggcgaatttggcgtactgcagattgatgcccat
tgcgacctgcgcgcttcatacgagctgtttacgtacagccatgccagtgttatgtacaac
gccctgaaagaaattcctaccctcacccacctggtgcagataggcgcccgcgattattgc
caggaagaatgggaatatattcagaacaacaaggaccgggtaataccctattttgataaa
gacatcaaagaacgccagttcgaaggggaaacctggaaacagataaccgacgagatcgtt
gggaaattgcccgaaaaagtgctggtaagttttgatattgatgggcttgatcctaaattg
tgtcccaatacaggcacccccgtacagggcggatttgaaaccgaacagatcttttacctg
ttaaaaaagattgtgcaaagcggtcgtaaatttattggtttcgatctggttgaaattggt
gtaggcgacaacaatgagtgggatgccaacgtgggtgcacacattttatggagattagcc
aatttactagtggccagtaatcaatag

DBGET integrated database retrieval system