KEGG   Niastella koreensis: Niako_1866Help
Entry
Niako_1866        CDS       T01679                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_1866
   01230 Biosynthesis of amino acids
    Niako_1866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_1866
   00030 Pentose phosphate pathway
    Niako_1866
   00051 Fructose and mannose metabolism
    Niako_1866
   00052 Galactose metabolism
    Niako_1866
  Energy metabolism
   00680 Methane metabolism
    Niako_1866
Enzymes [BR:nko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Niako_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2279673..2280593)
Genome map
AA seq 306 aa AA seqDB search
MIITITMNPAVDKSTTINKLVAEKKMRCSEMVTEAGGGGINVSKALKELGSDSLAVFPSG
GINGQLIEKYLQARDIPYQTIPIEKETRENIVVRENDTNLQYRFVMPGASLTEREAQLCL
QMIQQLQPAPDYIVASGSLPPGLPEHFFASLAKTAKQVHARFIIDTSGLPLQLAAKEGVY
LLKPNLSELCALAGVSYLPVNEVKDAALKVIKQQQCEVMVVSMGPEGALLVTHNGYEPVP
APTVKKQSTVGAGDSMVAGMVFMLSQGRSLPETVRFGVACGTAATMNPGTQLFKKEDVYQ
LYHRIS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgataataaccatcaccatgaacccggcggtagataaaagcaccactataaacaagctg
gtggccgagaaaaaaatgcggtgcagcgaaatggttaccgaagcaggcggaggcggtata
aacgttagtaaggccctgaaagaactgggcagtgattcgctggctgttttcccatcgggc
ggtatcaatggccagctgattgaaaaatacctgcaggcccgggacatcccttaccaaaca
attcccattgaaaaagaaacccgggaaaatattgttgtgcgggaaaacgataccaacctg
caataccgctttgtaatgcccggcgcttccttaaccgaaagggaagcgcagttatgttta
caaatgatacagcagttacagccggcgcctgactatatagtggccagcggcagcctgccc
cccggtttaccggagcatttttttgccagcctggccaaaaccgccaaacaggtacatgcc
cgttttatcatcgacacttcgggcctgcctttacaactggccgccaaagaaggcgtatac
ctgttaaaacccaatttaagcgaactatgcgccctggcgggcgtatcttacctcccggta
aatgaagtgaaggatgcagcccttaaagtgattaaacagcagcaatgcgaagtaatggtg
gtttccatgggccccgaaggcgccctgctggttacgcataatgggtatgaaccggtaccg
gctccaacggtaaaaaagcaaagcaccgtgggcgccggcgacagtatggtggccggcatg
gtgttcatgctgtcgcagggaaggtcattacccgaaaccgtacggtttggggtggcctgc
ggcactgccgccactatgaaccccggcactcagttgtttaaaaaggaagacgtttaccag
ctttatcacaggatcagttaa

DBGET integrated database retrieval system