KEGG   Niastella koreensis: Niako_2018Help
Entry
Niako_2018        CDS       T01679                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nko  Niastella koreensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nko00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2457492..2458319)
Genome map
AA seq 275 aa AA seqDB search
MYTLNCKGRLLVIDKPLVMGIINTTPDSFYEGSRFMGESGVLKQAEEMLKAGADILDIGG
QSTRPNSSTVSEDEELERVTGAIESLHYNFPEAVISIDTYYARVAAEAVAAGASIVNDVS
AGLVDPAIIATTGALRVPYICTHIKGTPATMQQHASYENVTREVLDFFIQKTAECHKAGI
KDVIIDPGFGFAKTPAHNFTLLKNLALLQLPDKPILIGLSRKSSVYKTLGITAQEALNGT
TVLNTIGLLNGAHILRVHDVKEAKEVVKLVDKLAS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgctgaattgcaaaggccgtttactggtaatagataaacccctggtgatgggc
attatcaataccactcccgattcgttttatgaaggaagccgttttatgggcgaaagcggg
gtgctgaaacaggcagaagaaatgttgaaagccggggccgacatcctggatattggcggg
caaagcacccgccccaacagcagcaccgtttcggaagatgaagaactggagcgggttacg
ggcgctattgaatcgttgcattataattttcccgaagctgttatttccatcgatacctat
tatgcccgggtagccgctgaagcggtggccgccggcgcgtccattgtgaacgatgtaagc
gccggactggttgatccggccattattgctaccaccggcgccctgcgtgttccctacatc
tgcacccatataaaaggaacgccggccaccatgcaacaacacgcatcgtacgaaaacgtt
acccgcgaagtgctggatttctttattcagaaaacggctgaatgccataaagccggcatt
aaagatgtgattattgatcccgggtttggctttgccaaaacacccgcgcataattttact
ttgctgaaaaacctggccctgcttcaactacccgataaacccatcctcatcgggctttcg
cgcaaatcatcggtttataaaacactgggcataactgcgcaggaagccctgaacggtact
acggtgttaaacaccatcgggctgctcaatggcgcgcatatcttacgggtgcatgatgtg
aaggaggcgaaggaagtagttaagctggttgacaagctggccagttga

DBGET integrated database retrieval system