KEGG   Niastella koreensis: Niako_2071Help
Entry
Niako_2071        CDS       T01679                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_2071
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_2071
   00052 Galactose metabolism
    Niako_2071
   00500 Starch and sucrose metabolism
    Niako_2071
   00520 Amino sugar and nucleotide sugar metabolism
    Niako_2071
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Niako_2071
   00524 Butirosin and neomycin biosynthesis
    Niako_2071
Enzymes [BR:nko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Niako_2071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2517407..2518447)
Genome map
AA seq 346 aa AA seqDB search
MTIKNLHIPKRSNLGENGVTVLAGDIGGTKTNLAFYLATDAGLKIIETGRYPSAEYASCV
AIMQQFLAEKKCPKPDRICLGVAGPVLNGKVNLTNLSWGIDIQDVKKSMGVEAVFLLNDL
ESMAYGLAGLTDDDFITLHAGDENSAGNMAINAPGTGLGQAGLFWNGQNHFPFPTEGGHA
DFSPRTDDDIALLKYLQKEYGVVSWEKVVAGPAIVDIYRFLRDVKKMEEPEWLKEELAKE
SPDSAVISGAAIENKSAICVEAMDLFVRYLARESSNLVLKLKATGGLFLGGGIPPKIAPL
LLQKQFMEHYMDCDRMQHLLENVPIRIIKNDKAGLIGAAWYGAYLM
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaaacctgcatattccaaagcgttctaacctgggtgaaaatggcgttacc
gtactggctggtgatatcggcggcacaaaaaccaacctggcgttttacctggctaccgat
gccggattgaaaataatagaaaccggcaggtacccctcagcagaatatgcatcgtgcgtt
gctattatgcaacagttcttagcagaaaagaaatgtccgaaacccgacaggatctgcctg
ggtgtggctggtcccgtactgaatggaaaagtaaacctcaccaacctgagctggggtata
gatatccaggatgtaaaaaaatcgatgggcgtggaagcggtatttctgttgaacgacctg
gagtcgatggcttatggactggcgggattgacagacgatgattttattaccctgcatgcc
ggcgatgaaaacagtgccggtaatatggccatcaatgcgccaggaacaggattgggtcag
gccggtttattctggaacggccaaaaccattttccctttccaacagaaggcggacatgct
gatttttcgccgcgcaccgatgacgacattgccttattaaaatacctgcaaaaagaatat
ggcgtagtgagctgggagaaagtggtggcagggccggccattgtagacatctatcgtttt
ttgcgtgatgtaaaaaagatggaagaaccggaatggttaaaagaagaactggcaaaagaa
tcacctgactctgctgttataagcggagcggctattgaaaataaatcagcgatctgcgta
gaggccatggatctgttcgtgcgctatctcgctcgcgaatcatcgaacctggtattgaaa
ctgaaagctaccggtgggttgttcctgggcggcggtattccacccaaaattgcaccgctg
ttattgcaaaaacaattcatggagcattacatggactgcgaccgcatgcaacatttactg
gagaatgtacccatcaggatcattaagaatgacaaagcgggtttgattggcgcagcctgg
tatggagcctatttgatgtaa

DBGET integrated database retrieval system