KEGG   Niastella koreensis: Niako_2129Help
Entry
Niako_2129        CDS       T01679                                 

Definition
L-glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
nko  Niastella koreensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nko00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nko00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:nko00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2581402..2582427
Genome map
AA seq 341 aa AA seqDB search
MKQLCFRKQTVLAFMFAVVCTTTSLGQLTLPPAEIEKALDEAYNKFKDLKEGKNADYIKE
LANVDPNIFGIALITIDGKVYTKGDINSMVSIQSVSKVFTMAKVIEEQGAKAIEDKIGVD
ATGMRFNSIVAIEMQKGKEINPLVNPGAIAASSMISGADSAAKWKSILQVQSDFAGRPLS
LNWPVYVSEAGDNLRNQAIAHLLLAYGRMYFDPVQSTDIYTKQCAINVNAKDLATMAATL
ANGGVNPITKKKVVSAETVMHTLPVMSTAGLYDNTGIWLYHTGLPAKSGVGGGLLAVCPG
KFGIAVVSPPLDEAGNSVKAQRVISYVVDKLKVNPYLVQPK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctatgttttaggaaacagacagtcctcgcatttatgtttgctgtggtttgc
actactaccagtttaggacagttaaccctgccgcccgcagagattgaaaaggcattagat
gaagcttacaataaattcaaagatctcaaggaaggcaaaaatgccgattatataaaagag
ctggccaatgtagatccgaacatttttggcattgcgctgataaccatcgatggaaaggtg
tataccaaaggcgatatcaactctatggtgtctatacaaagtgtatcaaaagtgttcact
atggcaaaagtgattgaagaacagggcgcaaaggctattgaagacaagatcggtgtggat
gctaccggcatgcggttcaacagtattgttgccattgaaatgcaaaagggcaaagagatc
aatccgctggtgaaccccggcgctattgccgcttccagtatgatcagtggcgccgactcg
gccgccaaatggaaaagcattctgcaggtgcaaagtgattttgccggccggccgctttca
ttgaactggccggtatatgtaagcgaagccggtgataatttacgcaaccaggccattgcc
cacctgctgctcgcttacggccgcatgtatttcgatcctgtacaatcaacagatatttat
accaaacaatgcgccatcaacgtaaatgcgaaagacctggccactatggctgccaccctg
gctaacggtggcgtaaatcccataacaaagaaaaaggtagtgtcggctgaaacggtgatg
catacgctgccggtgatgtctaccgccggtttatacgacaataccggcatctggttgtat
catacggggctgccggccaaaagtggtgtgggcggcggtttgctggctgtttgcccgggt
aaattcgggattgccgttgtttcgcctccgttggatgaagccggcaacagtgtaaaagcg
caacgggtgatcagttatgtagtggataagctgaaggttaacccctatctcgtacaacct
aaataa

DBGET integrated database retrieval system