KEGG   Niastella koreensis: Niako_2168Help
Entry
Niako_2168        CDS       T01679                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Niako_2168
   01230 Biosynthesis of amino acids
    Niako_2168
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_2168
   00051 Fructose and mannose metabolism
    Niako_2168
   00562 Inositol phosphate metabolism
    Niako_2168
Enzymes [BR:nko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Niako_2168
Exosome [BR:nko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Niako_2168
  Exosomal proteins of bladder cancer cells
   Niako_2168
  Exosomal proteins of melanoma cells
   Niako_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2625787..2626548)
Genome map
AA seq 253 aa AA seqDB search
MRKQIAAANWKMNCTYQQGEQLLDEILSANIELKAHQQTIFAVPFPYLIMAKSETEEENN
YFVAAQNCYNKKSGAYTGEVSVEMLQSIGIQFCVLGHSERREYFQESNKMLAEKLDLCLQ
YNITPIFCCGEPLNIREAGTQNSYVETQLKESLFHLSDADIKKVVIAYEPIWAIGTGKTA
TSEQAQEMHAFLRSVLAKQYGTTTADAVSILYGGSVKANNAKELFSCPDVDGGLVGGASL
NAGEFITIINSLK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaacaaattgccgcggctaactggaagatgaattgtacctaccaacagggtgaa
cagttactcgatgagatcctttctgccaacattgaattaaaagcacaccagcaaaccatt
tttgctgttccgttcccttacctcattatggcaaaaagtgaaaccgaagaagagaacaac
tacttcgtagctgcccagaattgttataacaagaaatccggcgcttataccggtgaagta
tcagttgaaatgctgcaatcgatcggcattcaattttgcgtgttgggccatagcgaacgc
cgcgaatatttccaggaatcgaataaaatgctggcagagaaactggacctgtgcctgcaa
tacaatatcacccccatattctgttgtggcgagccgctgaacattcgcgaggccggcacc
cagaacagctatgtggaaacccagttaaaagaatcgctgttccatttgtctgatgccgac
atcaaaaaagtggtgatcgcctatgaacccatctgggcaattggtaccggtaaaaccgcc
acctctgaacaggcacaggaaatgcatgcctttttgcgcagcgtgctggccaaacaatat
ggcacaactactgccgatgctgtttctatcttatatggcggcagcgtaaaagccaataac
gccaaagaattgtttagctgtcctgatgttgatggcggactagttggcggcgcctctttg
aatgcgggcgagtttattacgatcatcaatagtttaaaataa

DBGET integrated database retrieval system