KEGG   Niastella koreensis: Niako_2284Help
Entry
Niako_2284        CDS       T01679                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nko  Niastella koreensis
Pathway
nko00010  Glycolysis / Gluconeogenesis
nko00020  Citrate cycle (TCA cycle)
nko00620  Pyruvate metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Module
nko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_2284
   00020 Citrate cycle (TCA cycle)
    Niako_2284
   00620 Pyruvate metabolism
    Niako_2284
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Niako_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: AEV98632
UniProt: G8TJ99
Position
complement(2755530..2756609)
Genome map
AA seq 359 aa AA seqDB search
MIEFNMPSLGADMEAGTLREWLVKPGDKVKRGDIIAVVETQKGLIDIEVFDEGIIDQLLI
GQDEKVPVGKVMALIANGASPKTPVLPQVKASPLAKRMAAEKGIDLQTIIGTGEGGAITK
EDVEKAAGQKRVVTEIKPPASESIRMAVAAAMSKSNREIPHYYLQQKIDMRRALTWLSEA
NKLRNVKQRLLPVVLLVKSVAAALVAVPQLNGFWENGFQQMNEINIGFAISLRSGGVMIP
AIRNADKKSLDELMAALNDIIPRARAMKLRSSELSSSTITITSLGEANAELVYGVIYPPQ
VALVGFGSIIEQPWAEQGMLDVRPVITATVAADHRATDGTTGSRLLMHINNQLQKPELL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgattgaatttaatatgcccagcctcggcgccgacatggaggcaggaacgcttcgtgaa
tggctggtaaagcccggtgataaggtaaaacggggcgacattattgctgttgttgaaacg
caaaagggacttattgatatcgaagtatttgacgaaggtattattgatcagctgttgatt
ggtcaggatgaaaaggtacccgtaggaaaggtgatggccctgatcgcaaacggtgcatct
cccaaaacgcccgttttaccacaggtaaaagcctcgccgctcgcaaaacgcatggccgct
gaaaaaggcatagatctgcaaacaataataggaacaggagaagggggtgccattacgaag
gaagatgtggaaaaagctgccggtcaaaaacgggttgttacagaaattaaaccgccggct
tcagaaagcatcagaatggcagtggctgcagccatgagtaaatcgaacagggaaattccg
cactactatttgcaacagaagatcgatatgcgcagagcgcttacctggttaagtgaagcc
aataaactaagaaacgttaaacaacgcttactcccggtagtactcctggtaaaatcggtt
gcagcggccctggtagccgtaccgcaattaaatggattctgggaaaacgggtttcagcag
atgaacgaaataaatatcggatttgctatttcattgcgctccggtggagtaatgatcccg
gctatccggaatgcagataaaaagtcactggatgagttgatggccgcattaaacgatatt
ataccaagggcaagggccatgaaactgagaagctcggagttaagttcctccaccattact
attacgagtttgggtgaagccaatgcagaacttgtttacggagtgatctatccgccacag
gtagcattggttgggtttggaagcattattgaacagccctgggccgaacagggcatgctg
gacgttcgcccggtaattacagccaccgtcgccgcagatcaccgggcaacggatggcaca
acaggcagcaggttgcttatgcacattaataaccaacttcaaaaacctgaattattatga

DBGET integrated database retrieval system