KEGG   Niastella koreensis: Niako_2293Help
Entry
Niako_2293        CDS       T01679                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nko  Niastella koreensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Niako_2293
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_2293
  Lipid metabolism
   00071 Fatty acid degradation
    Niako_2293
  Amino acid metabolism
   00350 Tyrosine metabolism
    Niako_2293
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Niako_2293
   00626 Naphthalene degradation
    Niako_2293
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Niako_2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766866..2767885)
Genome map
AA seq 339 aa AA seqDB search
MATNLAATMHAMVLESAGQPLVYKTLPVPAPAADQLLVKVIACGVCRTDLHIVDGELDSP
KLPLVPGHEIIGEVVQTGKEIMSFKAGDIVGIPWLGYTCGKCRYCLKGQENLCANARFTG
YTLDGGFAEFAVADSRYCFLLPANYANAQYAPLLCAGLIGFRSYRMIGDDAQKIGIYGFG
AAAHILIQIALFEGKKIFAFTRPDDRDAQQLALQLGAHWVGDSLHPCPEPLDAAIIFAPV
GSLVPIALQDTDKGGIVICGGIHMSDIPSFPYKWLWNERKLQSVANLTRNDGKAFFEMVS
RTAIHTQTKMYPLMEANTALNDLRNGAFQGAAVLVNGNI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaatcttgctgcaaccatgcacgccatggtgcttgaatcggccgggcaaccg
ttggtgtataaaaccctgcctgtgcctgctcccgctgctgaccagttgttggtaaaagta
atagcctgcggcgtttgtcgtacagacctgcatattgtagacggggagctcgattcgccc
aaattgccacttgttcccggtcatgaaattataggcgaggtagtacaaaccggcaaagag
ataatgtcatttaaagcgggtgatatagtgggcattccctggttagggtatacctgtggt
aaatgtcgctattgtttaaaagggcaggagaacctgtgtgccaacgcccggtttactggc
tatacgctggatggcggttttgccgaatttgcagtagctgatagccggtactgcttttta
cttccggccaattacgctaatgcgcaatatgcgccactgctatgtgccggtttaataggg
ttcaggtcttaccggatgattggagatgatgcgcagaagataggcatttatggatttggc
gctgccgcacatatacttattcagatagccttgttcgaagggaaaaaaatattcgcgttt
accagaccggatgaccgcgatgcccaacaactggccttacaattaggtgctcattgggta
ggcgattcattacatccatgtcccgaaccgcttgatgccgctatcatttttgcgcctgta
ggctctctggtgcctatagctttacaggatacagataaaggcggtatagttatttgcgga
ggcattcatatgagcgatattccttccttcccttataaatggttatggaacgaaagaaag
cttcaatccgttgccaatcttacccgtaatgatggcaaggcattctttgagatggtttcc
agaacagccattcatacccaaacaaaaatgtatccattaatggaagctaataccgcattg
aacgacctgcggaatggtgcttttcagggcgcggctgtacttgttaacggtaatatttaa

DBGET integrated database retrieval system