KEGG   Niastella koreensis: Niako_2443Help
Entry
Niako_2443        CDS       T01679                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
nko  Niastella koreensis
Brite
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Niako_2443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3047574..3048704
Genome map
AA seq 376 aa AA seqDB search
MKKIISFVIIITTISCAPRQIQAQQEQSIPSLKETFKNDFLIGTAINPAQIEEKDPAAAR
LIPMQFNAVTPENSMKAAFIHPGWDQYNFTLADQLVEYGKKHHIKITAHTLIWHSQLPGF
VRGMKNPDSLRQYFTNHITTLASRYDGKVFSWDVVNEALDDNGSLRQSIFLQQLGEDYIV
EAFRLAQQAAPHTELYYNDYNIEQPKKRAGAIALIKKIKKAGVRIDGVGIQGHWRASHIP
LAEIEQSILDFSALGVKVMFTELDLSVLPNPWDRDNADVSATADNSTAKDPYPNGLPDSM
QTVLAKGYEDLFNLFVKHKDKISRVTFWGVNDGQSWLNNFPVRGRTNYPLLFDRAFNAKP
AFYSVIATGKERTAAK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcatttccttcgtaattattatcactaccatttcctgtgcgccccgccaa
atccaggcacaacaggaacagtccatcccttcgctgaaagaaacatttaaaaacgacttt
ttgataggtactgcaataaaccccgcacagatcgaggaaaaagacccggctgccgcccgg
ttgatacccatgcaattcaacgccgtgacccctgaaaacagcatgaaagcggcctttatt
cacccgggttgggaccaatacaatttcacgctggccgaccaactggttgaatacggtaaa
aagcaccatatcaaaataactgcgcatacacttatctggcacagccagttgcccggcttt
gtaagaggcatgaaaaatcctgattcgctcaggcaatattttaccaatcacataaccacc
ctcgccagccggtacgacgggaaagtattttcctgggatgttgtaaatgaagcgctggat
gataatggctccctgcgccaatcgatcttcctgcagcaactgggcgaagattatatagtg
gaagctttccgtttggcgcagcaggccgcccctcatactgaattatattataacgactat
aacatagaacaacccaaaaaaagagccggggccattgcgctcatcaaaaagatcaaaaaa
gcaggcgttcgcatcgatggtgtcggcatccaggggcattggcgcgcttcgcacattcca
ttggctgaaatagaacaaagtattcttgacttttcagcgcttggcgtgaaagtgatgttc
accgagctggacctgagtgtactgcccaacccatgggacagggataatgctgatgtaagc
gccacggccgataacagcactgccaaagatccctaccctaacggcctgcccgattccatg
caaacagtattggccaaaggttatgaagacctgtttaatttatttgtgaaacacaaagac
aagatcagccgcgttaccttctggggggtgaatgatggtcaatcgtggttaaacaatttt
ccggtgcgtggccgaaccaattatccgttgctgttcgaccgcgcgttcaatgccaaaccg
gccttttattcggtgatagcaaccgggaaagagagaactgctgcaaagtaa

DBGET integrated database retrieval system