KEGG   Niastella koreensis: Niako_2562Help
Entry
Niako_2562        CDS       T01679                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nko  Niastella koreensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Niako_2562
Enzymes [BR:nko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Niako_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3182163..3184850)
Genome map
AA seq 895 aa AA seqDB search
MTIHFYIRFFTRPGESLFVTGNTDELGNNDIDKAHPLTWLSHDLWTGTVTINNPQIDVIH
YSYIYKGMDGYQVQEWDDHKTIDISKKPMQEIRVMDTWNSAGEFENAFYTDPFQEILLKE
QETRSKAKAVKNATHYFKVKAPLLEKNEVVCLLGSNKALADWDQEEPVLLHRENNWWAVK
LHLPKESFPIQYKYGVYNIKSNSFVRFETGENRWLHGDALVNTLTILHDGFVHLPNTTWR
GAGVVLPVFSLRSKNSFGTGEFTDLKLLVDWAVKTGMKMIQILPVNDTTATHTWMDSYPY
AAISAFALHPLYLNITKVAGKEFADLIKPLKKKQVQLNELAEVDYEAVMHVKLAAIKELY
MVQKEKWLKDPDFAKFFYQNEHWLVPYAVFCSLRDRFGTADFNQWKTNNIYNKEAILKLA
SPKSKQYDEVAIHYFTQYHLHSQLQEAAAYAHKNGVILKGDIAIGVYRYGSDAWQKPELY
HMEMQAGAPPDDFAVRGQNWGFPTYNWERMAADGFEWWHQRFVQMSNYFDAFRIDHILGF
FRIWSIPMHAVEGIMGFFVPALPVHVEELEQRGIWFTPVRYCQPYINDTVLWEMFGPNKE
KFYPYLDSAGNQFTLKPEFATQRQVELHFDALERSEENQHLRQGLYDLISNVILFEQPGS
NGREFHFRISMENTTSFKHLEGYVQDRLKELYINYFYQRQEHFWMQEGLRKLPALKRSTN
MLICGEDLGMVPQCVPVVMKQLGIVSLEIQRMPKDIHSEFFHPAQAPYLSVVTPSTHDMS
TIRGWWEEDRTKTQRFFNTVLGQWGEAPATCEAWINKAIVIQHLQSPAMWATFQLQDLLG
MNETLRRENPAEERINIPAIPKHYWRYRMHLTLEQLLKEKEFNEEVEEYVKDSGR
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atgactatccatttttatataagatttttcacccggcccggcgaatccctttttgtaacc
ggcaataccgacgagttgggaaataacgatattgacaaggcgcacccgttaacctggctt
agtcacgacctttggacgggcacggtaaccattaacaatccacaaatcgacgtcattcat
tacagttacatttataagggcatggatggttaccaggtgcaggagtgggacgaccataaa
accattgacatctccaaaaagcccatgcaggagatcagggtgatggatacctggaactct
gccggcgaatttgagaacgctttttataccgatcccttccaggagatcctgctcaaagaa
caggaaacccgcagcaaggccaaggccgtaaaaaatgccacgcactattttaaagtaaaa
gcaccattgctggagaaaaatgaagtagtgtgcctgctgggtagcaacaaagctttagcc
gattgggaccaggaagaaccggtattactgcaccgtgaaaataactggtgggcggtaaaa
ctgcatttaccaaaggaatcattccccattcaatacaaatacggggtatataatataaaa
agcaacagctttgtacggtttgaaaccggggaaaaccgctggctgcatggcgatgccctg
gtaaacaccctcaccattttacacgatggctttgtacacctgcctaatacaacctggcgg
ggcgccggtgtggtgttacccgtctttagcttacgcagcaaaaactcgtttggcaccggc
gaattcaccgacctgaagctgctggttgactgggccgtaaaaaccggcatgaagatgatc
cagatattgccggtgaacgacaccaccgccacccatacctggatggattcttatccttac
gccgctatctcggcatttgccttacacccgctgtacctgaatattacaaaagtggctggt
aaggaatttgccgacctcataaaaccgcttaagaaaaagcaggtacagttaaatgagctg
gccgaagtagattatgaagccgtgatgcatgtaaagctggccgccattaaggaattgtac
atggtgcaaaaagagaagtggttaaaagaccctgattttgccaagttcttttaccagaat
gaacactggctggtgccctatgcggttttctgcagcctgcgcgatcgctttggaacggcc
gattttaaccaatggaaaacgaataatatttacaataaagaagccatcctgaaactggct
tcgcccaaaagcaaacaatacgatgaggtggccatccattactttacgcaataccatttg
catagccagttacaggaagctgccgcctatgcgcataagaatggtgtaattctgaaaggt
gatattgccattggggtataccgttatggcagcgatgcctggcagaagcccgaactttat
catatggaaatgcaggccggcgccccgccagatgattttgccgtacgcgggcagaactgg
ggctttcctacgtataactgggagcgtatggcggccgacgggtttgaatggtggcaccag
cggtttgtacaaatgagtaactacttcgatgccttccgcatcgatcacatcctcgggttc
ttccgcatctggagtattcccatgcacgctgtagagggaatcatgggcttttttgtgccc
gcattaccagtgcatgtagaagagctggaacaacgcggcatctggttcacgccggttcgg
tattgtcagccatacatcaacgatacggtgttgtgggaaatgtttggccccaataaagaa
aagttctatccctatttggatagtgccggaaaccagttcacgttgaaaccagaatttgcc
acccagcgacaggtggaattgcatttcgatgcactggagcgcagtgaagaaaaccagcac
ttgcggcaaggcttgtacgatcttatttccaacgtcatattgtttgaacaaccagggtcg
aacgggcgggaatttcatttccgcatcagtatggaaaacaccacttccttcaaacacctg
gaagggtatgtgcaggatagactgaaggaattgtatataaattatttttaccagcggcag
gaacatttctggatgcaggaagggttacgtaaattgccggcgctaaagcggtcgaccaac
atgcttatttgcggggaagacctgggcatggtgccacagtgcgttccggtggtaatgaaa
cagctgggtattgtgagcctggaaattcaacggatgcccaaagacatccacagtgagttc
ttccatccggcacaggcgccgtacctgtcggtggtaacgccatcaacgcacgatatgagc
accatccgcggttggtgggaagaggaccgcacaaaaacgcaacggttctttaacacggta
ttggggcaatggggcgaagcgccggccacctgtgaagcgtggatcaataaggccattgtg
atccagcacctgcaatcgcctgccatgtgggcaacatttcagctgcaggatctgttaggc
atgaatgaaacccttcgccgcgaaaacccggcggaagaacgcatcaacatcccggccatt
ccaaaacattactggcggtaccggatgcatttgacgctggaacagctgctgaaagaaaaa
gagtttaatgaggaagttgaagagtatgtgaaagactcaggaagatga

  All links  
No link information was found.   
DBGET integrated database retrieval system