KEGG   Niastella koreensis: Niako_2844Help
Entry
Niako_2844        CDS       T01679                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nko  Niastella koreensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Niako_2844
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Niako_2844
Enzymes [BR:nko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Niako_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3560457..3561359)
Genome map
AA seq 300 aa AA seqDB search
MTGHKINLFEFPTNLGLIKTDYAIEPGVKKLPDWLKQFGFHDQVNPDKVVRLEPPAYTML
VDKASQVRNADSIVAYAKEQAALLYNEINDDSFQLILGGDCSILIGSAVALRQKGKYGIF
YLDGHTDFIWPEMSGTHGAAGMDLAIVAGHGHEKLTNINNLKPYIQEEHIYCVGNREYDA
NYEKPVIDSNVAYYPLNRLRGNGLQNTVQQFLQTVKQQNLDGFFIHFDVDALDDQVMPAV
DSRTPDGLSYDELAEILAPLLSSRKAVGMEITILDPDLDEDGRYTKEFSDKIVKLINGAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccataaaataaacctgttcgaatttccaaccaacctgggattgataaaaacc
gattatgccattgagccaggtgtaaagaagttgcccgattggttaaaacaattcggtttt
catgatcaggtcaatcctgataaagttgttcgtttggaaccaccggcttataccatgctg
gttgataaagcatcgcaggtaagaaatgccgatagtattgtggcctatgcaaaagaacag
gctgcgcttttgtacaacgaaatcaatgatgattcttttcaactgatccttggtggtgat
tgcagtattcttatagggagcgctgttgcattgcggcaaaaagggaagtatggaatattc
tacctggacggacatactgattttatctggcccgaaatgtcgggcacccatggcgctgct
ggtatggatctcgctatagtagcgggtcacggccatgaaaagctgactaatatcaataat
ctgaaaccatatatccaggaagaacatatttactgtgtgggtaaccgcgagtacgatgct
aattatgagaaacctgtcatcgactccaatgtagcctattatccactcaatcgcttacgg
ggaaatggattgcaaaataccgtgcaacaatttcttcaaacggtgaaacaacaaaacctg
gatgggttctttattcattttgatgtggatgccctggatgaccaggttatgccggcggtt
gacagccgcacaccagatgggctttcgtacgatgagctggctgagatcctggctccatta
ctatcgagcaggaaagcagttggcatggaaattaccatcctcgatcctgatctggatgag
gatggtaggtatacaaaagagttcagtgataaaatagttaagctaataaatggggcaaaa
taa

DBGET integrated database retrieval system